mpidb The Microbial Protein Interaction Database Functional characterization of the type III secretion ATPase HrcN from the plant pathogen Xanthomonas campestris pv. vesicatoria. Functional characterization of the type III secretion ATPase HrcN from the plant pathogen Xanthomonas campestris pv. vesicatoria. J. Bacteriol. (0021-9193) 2009 imex curation Lorenz C., Büttner D. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lorenz C., Büttner D. Accepted 2013-JAN-11 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation Functional characterization of the type III secretion ATPase HrcN from the plant pathogen Xanthomonas campestris pv. vesicatoria. Functional characterization of the type III secretion ATPase HrcN from the plant pathogen Xanthomonas campestris pv. vesicatoria. J. Bacteriol. (0021-9193) 2009 imex curation Lorenz C., Büttner D. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lorenz C., Büttner D. Accepted 2013-JAN-11 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation q3byl8_xanc5 xopF1 XCV0414 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MKLSSDIGTAASRGAASHPPVQPTQAEDVAAPREERAPTGPLAGLASSSAALRGRRASLAGRASPHADEEGAMLGGSHRSDSSQSSQASDATFYTAQVVSPAREIDTPDVPAAAATYAERSTAAAAEVKAQLRARLDALPFAAPSEEQTALQASYLEWADARVQERINAFGPDAGYQAVGDMKTAGTKAALPIAYECLRSFIIGAMRIPVGLATGAAYASRRPADAEELSTAMVAGVAAGSASYTSDTLLIPAMDRRAPVSNLPRFQAIDPKILVPDPPPVILEITAEGKRFTRPGENNAPTLADLKAQTYDRRLGITQRQSTLDDKSLDTLLLKPVINAGFNAARRTGGEPGLLTPVGQWGLSALAIGGAGVVQKALLETGKAVARTGQMRVPDLVGGEQRLNLFALALPDKARRPAQWSDAVHFPPTYLLDTGKEALALARQGFNSANAVATTARDLLTRHMLSNVMASFGPMGAGRIITAPLRRGSHIRVAGEAVNSTAVVVQQAVQTLFNDTFWNALKAKNGANTSQAARLDNERAALAAEHQRTIERTLEALAEPVDQAIARLSGPTPAEAERAMEEGMRAAPGPGPLGQTLRTALQTLRTEIGTQSVSIATIDAVRTALREGWSQTFSGVPRDAATQALDGQLQTLKRALHDSEALRQWQSGRA E3E1469DB2A9D449 q3byk6_xanc5 hrcU XCV0426 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MSEEKTEKPTEKKLRDARKDGEVPVSPDVTAAAVLFGALLVMKSAGDYFSDHMRALMTIGFDFSEHTRDAAAINRALGHIGIQGLLLMLPFLAACLVAGMAGGAFQTGLNASLKPVAPKFDSLNPATGVKKLFSLRSLINLLKLIIKAILIGVVLWVGIRALMPMIIGLAYETPLDVAQIAWRTLGMLFALGVLLFVLVGAADWSVQRWLFIRDKRMSKDEQKREVKESEGDPEIKDKRKEFAKELVFGDPRERVAKAKVMVVNPTHYAVALAYEPDDFGLPQVVAKGVDDGALELRAFAHNQGIPIVANPPLARALYQVELGDAIPEPLFETVAVVLRWVDELGRDHGDGDGALPC 634F317C1D7F8D11 q3byl6_xanc5 hpaB XCV0416 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MSSARFETIVRQMCEALDLPDVESVLDRRVLWVEGFEVYLHLPTPQPEDDVKEEALYLRIAYGLPPAGRTLTVFRLLLEANLSVYAQDQAQLGLNDDGVIVLIVRVPLDDDVDGAWICDLLAHYAEHGRYWNNNIFVAHDEMFEGIATGNYLWLRA BE3E93A2C930FB5D q3byk8_xanc5 hpaC XCV0424 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MRKPPLRHVRILPVSGALQRPAAPATPARSALRSSFLQLRQRLRSAQLALPCMVLPPQCDEDRPGPDAEEGFTEAHDSVPVQTDPPLRIEGTKHQEPSQGNDDGAVGRQIATEWIRTQRAHMAIDHIALRVAEFCNAQPVRSAGSWEAWLAIDQEVVAQTTLFLRLSPDQLSLRFNTSSPDAREVLWCGKQRLEAALTSTLSSTLQISIEVV 739C452C6BCE3169 q3byk1_xanc5 hrcL XCV0431 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MRLWLRSTPDAIGLDCDVIPREALASVLALDAATAEVHARCEQALSQAQTRAQTLVDEAQQQAEAILHDARQKAERSARLGYAAGLRRQLDEWNESGLRHAFAAEAAAQRSRERLAEIVARTCEHIILGHDPAALYARAAQALEGALDEAKALRVSVYPDAVDAARRAFDAAATEAGWTLQVELCGDADLAVGACVCEWDTGVFETDLRDQLSSLRRVIRRVLAAPQEPADAG 544B4D7A0C517A23 q3byk0_xanc5 Type 3 secretion system ATPase hrcN XCV0432 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MLAETPLLETTLERELATLAVGRRYGKVVEVVGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVGTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLSRVMSQIVPYDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGSDAVADEAIDRIDAIRDFLSQPTDQLSAYENTLELLTSVTDDA 6CE6D8B31F071E88 hrcn-hpac 1 6 unspecified role unspecified role prey prey region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 3C hrcn-hpab 1 8 unspecified role unspecified role bait bait region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association Fig. 3B hrcn-hrcl 1 7 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 4A hrcu-hpab 1 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association Fig. 8C, 8D hrcu-hrcl 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association Fig. 8B hrcu-hrcn 1 8 unspecified role unspecified role prey prey region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 8A hrcl-hrcn 2 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association Fig 4B hpab-hrcn 1 3 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role bait bait c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 8 competitor competitor competitor prey prey region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 3A