mpidb The Microbial Protein Interaction Database Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Mol. Microbiol. (0950-382X) 2009 imex curation Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Mol. Microbiol. (0950-382X) 2009 imex curation Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Mol. Microbiol. (0950-382X) 2009 imex curation Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. Mol. Microbiol. (0950-382X) 2009 imex curation Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation q9rez7_borbo bsp22 protein protein borbo Bordetella bronchiseptica MTIDLGVSLTSQAGGLQGIDLKSMDIQTLMVYVQGRRAELLTAQMQTQAEVVQKANERMAQLNEVLSALSRAKAEFPPNPKPGDTIPGWDNQKVSRIEVPLNDALRAAGLTGMFEARDGQVTAPGGRGTQVVNGTGVMAGSTTYKELESAYTTVKGMLDTASNTQQMDMIRLQAASNKRNEAFEVMTNTEKRRSDLNSSITNNMR DB2F01EA1898A204 q9rez6_borbo bopD protein protein borbo Bordetella bronchiseptica MSVSPTSPGSFGAGPVFDSELQAPAPSAQRRGGAAPVPPPVDRRGVEPGDPTLGMLPAPDLLAGGAVSRTRAALDDLDAARLGEDIYTLMAVLQQASQQMREAARIARDAEATRQTQAIGDAASQMRQAANERMAGAIVAGAMQIAGGFVQLGAGLAAGLQAMGGAAAQAKGAAFSEQASTSRKVAAGLHDAPELQATVQARATQLEAQAASFGADAARSSAKSQRVSSVAQAGAATAGGIGGLTSAAQERRAAEHEARRAELDVEAKVHETASRRADEAMQQMLDIIRGIREKLAGMEQSRSETARSVARNI B62526B820EB1887 q9rez5_borbo bopB protein protein borbo Bordetella bronchiseptica MTVMSTTISTAPSGAALAPSRIDMRAPEPGSAGEGAGILAPVTTLALAAGRPAFPASPSLRTAPVLDPPVRDLSPADLADLLRVLRSRAVDGQLATARENLQDAQVKAKQNTQAQLDKLDAWFRKAEEAESKGWLSKVFGWIGKVLAVVASALAVGFAAVASVATGAAATPMLLLSGMALVSAVTSLADQISQEAGGPPISLGGFLSGLAGRLLTALGVDQSQADQIAKIVAGLAVPVVLLIEPQMLGEMAQGVARLAGASDATAGYIAMAMSIVAAIAVAAINAAGTAGAGSASAIKGAWDRAAAVATQVLQGGTAVAQGGVGVSMAVDRKQADFLLADKADLAASLTKLRAAMEREADDIKKILAQFDEAYHMIAKMISDMASTHSQVSANLGRRQAV 1AB5DA4BEBADDAC2 bopd-bopb 4 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 2A bopd-bsp22 4 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 2A bsp22-bopd 3 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 2B bsp22-bsp22 4 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 2A bsp22-bsp22-1 3 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 2B bsp22-bsp22-3 1 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 3C bsp22-bsp22-4 2 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 3C