mpidb The Microbial Protein Interaction Database The thioredoxin reductase-glutaredoxins-ferredoxin crossroad pathway for selenate tolerance in Synechocystis PCC6803. The thioredoxin reductase-glutaredoxins-ferredoxin crossroad pathway for selenate tolerance in Synechocystis PCC6803. Mol. Microbiol. (0950-382X) 2009 imex curation Marteyn B., Domain F., Legrain P., Chauvat F., Cassier-Chauvat C. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Marteyn B., Domain F., Legrain P., Chauvat F., Cassier-Chauvat C. Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The thioredoxin reductase-glutaredoxins-ferredoxin crossroad pathway for selenate tolerance in Synechocystis PCC6803. The thioredoxin reductase-glutaredoxins-ferredoxin crossroad pathway for selenate tolerance in Synechocystis PCC6803. Mol. Microbiol. (0950-382X) 2009 imex curation Marteyn B., Domain F., Legrain P., Chauvat F., Cassier-Chauvat C. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Marteyn B., Domain F., Legrain P., Chauvat F., Cassier-Chauvat C. Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation p74746_syny3 slr0600 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MKLSSKNLDARLDTVYDAIVLGGGMGGLSAAIYLARYGLKCLVVEKGRGRSFWMQDLRNYVGLDPDTPGRDIITHSTQQALHWGADLLRGYVEDVTDEGDTLAVKVKVGKKDSLYPIFRTKYVIAATGIIDNLPQLEDMQNVYDYAGYTLHVCMICDGFDMWDQKAVLIAGTEGQINAAFVLNWFTPYITVLTHGLCTVGDEMKAKLADHGYPLHEAAITKFLGEDHKMSGVELVDGTVVEATTGLINMGSVYHNHYLKGIEGLEWDGENLVTNDMAQTSHPRIFALGDLKKGLNQVSVAVADGTLAATQIWRNIRRASEPRKWIH 58AE1A702D46E243 glrx2_syny3 Probable glutaredoxin ssr2061 ssr2061 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MAVSAKIEIYTWSTCPFCMRALALLKRKGVEFQEYCIDGDNEAREAMAARANGKRSLPQIFIDDQHIGGCDDIYALDGAGKLDPLLHS 4F0588531B0ECCB6 ftrc_syny3 Ferredoxin-thioredoxin reductase, catalytic chain ftrC Ferredoxin-thioredoxin reductase subunit B sll0554 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTSSDTQNNKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHKEELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHCMLFLTPDNDFAGDAQDIPMETLEEVKASMA DIP protein Q55389 original sequence version: 80 93B2F674C59A3CCE q55980_syny3 Ferredoxin sll0662 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MVIADLNFPPDHRSGLEPELGGDWRNFDDRSGLEPELGGELRERGVYVDEVTCIGCKNCAHVAPNTFTIEQEHGRSRAFSQNGDDEAVIQEAIDTCPVDCIHWVPYDELKHLEEKRKHQQIRPLGYPQINPHL A7B7D58749099B33 glrx1_syny3 Probable glutaredoxin slr1562 slr1562 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MANLFNWLPLLSGRQADGIKAKVEIYTWQTCPFCIRAKLLLWWKGVKFIEYKIDGDDQARQAMAARAEGRRTVPQIFVNDQGIGGCDQLYGLDSRGQLDPLLATPPNPA 757C3D327D457332 q55980-glrx2 1 6 unspecified role unspecified role bait bait Q55980:p.Cys96Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:43:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys96ser' Tue Jun 30 17:20:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys96Ser' Q55980:p.Trp103_Val104delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain WV AA Thu Jul 07 12:17:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val103_trp104ala Fri Jul 22 10:54:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp103ala,val104ala' Wed May 02 14:43:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_val103-104ala_ala' Tue Jun 30 19:01:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp103_Val104delinsAlaAla' Q55980:p.[Cys53Ser;Cys56Ser;Cys59Ser] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:58:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys53ser,cys56ser,cys59ser' Tue Jun 30 20:10:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys53Ser;Cys56Ser;Cys59Ser]' Q55980:p.Cys53Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:46:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys53ser' Tue Jun 30 15:42:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys53Ser' 4 unspecified role unspecified role prey prey P73492:p.Cys18Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:35:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys18ser' Tue Jun 30 16:40:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys18Ser' P73492:p.Cys36Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:44:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys36ser' Tue Jun 30 17:59:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys36Ser' P73492:p.Cys15Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:24:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys15ser' Tue Jun 30 18:23:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys15Ser' P73492:p.Leu22Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L K Wed May 02 19:20:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu22lys' Tue Jun 30 20:13:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu22Lys' physical association physical association Table 4 p74746-glrx1 1 3 unspecified role unspecified role bait bait P74746:p.Cys153Ser P74746-153-153 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:50:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys153ser' Tue Jun 30 18:43:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys153Ser' P74746:p.Cys197Ser P74746-197-197 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:39:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys197ser' Tue Jun 30 16:49:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys197Ser' 7 unspecified role unspecified role prey prey P74593:p.Cys86Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:34:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys86ser' Tue Jun 30 20:14:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys86Ser' P74593:p.Cys34Ser P74593-34-34 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:48:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 20:14:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' P74593:p.Cys31Ser P74593-31-31 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:30:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys31ser' Tue Jun 30 16:42:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys31Ser' physical association physical association Table 1 glrx2-glrx1 1 7 electron acceptor electron acceptor prey prey P74593:p.Cys34Ser P74593-34-34 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:17:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 20:05:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' P74593:p.Cys31Ser P74593-31-31 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:17:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys31ser' Tue Jun 30 18:35:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys31Ser' P74593:p.Cys86Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:54:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys86ser' Tue Jun 30 20:00:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys86Ser' 4 electron acceptor electron acceptor bait bait P73492:p.Cys36Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:38:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys36ser' Tue Jun 30 18:24:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys36Ser' P73492:p.Cys18Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:16:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys18ser' Tue Jun 30 18:27:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys18Ser' P73492:p.Leu22Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L K Wed May 02 20:28:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu22lys' Tue Jun 30 19:49:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu22Lys' physical association physical association glrx1-p74746-2 1 7 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Table 4 q55980-ftrc 1 5 unspecified role unspecified role prey prey Q55389:p.Cys56Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:25:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys56ser' Tue Jun 30 16:21:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys56Ser' 6 unspecified role unspecified role bait bait physical association physical association Table 4 glrx2-q55980 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q55980:p.Trp103_Val104delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain WV AA Thu Jul 07 12:18:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val103_trp104ala Fri Jul 22 11:01:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp103ala,val104ala' Wed May 02 17:06:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_val103-104ala_ala' Tue Jun 30 16:54:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp103_Val104delinsAlaAla' ecolx Escherichia coli direct interaction direct interaction Fig. 5