mpidb The Microbial Protein Interaction Database Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. Mol. Microbiol. (0950-382X) 2009 imex curation Ulijasz A.T., Falk S.P., Weisblum B. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ulijasz A.T., Falk S.P., Weisblum B. Accepted 2013-FEB-05 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. Mol. Microbiol. (0950-382X) 2009 imex curation Ulijasz A.T., Falk S.P., Weisblum B. Only protein-protein interactions in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Ulijasz A.T., Falk S.P., Weisblum B. Accepted 2013-FEB-05 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. Mol. Microbiol. (0950-382X) 2009 imex curation Ulijasz A.T., Falk S.P., Weisblum B. Only protein-protein interactions in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ulijasz A.T., Falk S.P., Weisblum B. Accepted 2013-FEB-05 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation b5e7b7_strp4 ritR SPG_0342 protein protein strain g54 Streptococcus pneumoniae serotype 19F MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVFIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREYDLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRGVGYTMQE The sequence has been withdrawn from uniprot. 1DB184E9F7E64490 a0a0h2unk2_strpn SP_0376 protein protein strpn Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLMLLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREYDLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRGVGYTMQE E9BF60EE0C82EA39 b5e778_strp4 SPG_1637 protein protein strain g54 Streptococcus pneumoniae serotype 19F MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVSQSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLIWILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTGRKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESEAGTVLKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENLIKIEEEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLIQIVGIKEANIEVVEVTTAPAGSAEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP The sequence has been withdrawn from uniprot. 53A12BD40A8F3BED phpp_strpn Protein phosphatase PhpP phpP PP2C-type phosphatase Ser/Thr phosphoprotein phosphatase protein protein strpn Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) MEISLLTDVGQKRTNNQDYVNHYVNRAGRTMIILADGMGGHRAGNIASEMAVTDLGVAWVDTQIDTVNEVREWFAHYLEIENQKIHQLGQDEAYRGMGTTLEVLAIIDNQAIYAHIGDSRIGLIRGEEYHQLTSDHSLVNELLKAGQLTPEEAEAHPQKNIITQSIGQKDEIQPDFGTVILESGDYLLLDSDGLTNMISGSEIRDIVTSDIPLADKTETLVRFANNAGGLDNITVALVSMNEEDAE CDD968CCE6E86E94 b5e778-ritr-1 1 6 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 4 ritr-phpp 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2 q97si5-phpp 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined dna binding region sufficient to bind sufficient binding region sufficient to bind range range range range 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 22 physical association physical association Fig. 3