mpidb The Microbial Protein Interaction Database Shigella flexneri type III secretion system effectors OspB and OspF target the nucleus to downregulate the host inflammatory response via interactions with retinoblastoma protein. Shigella flexneri type III secretion system effectors OspB and OspF target the nucleus to downregulate the host inflammatory response via interactions with retinoblastoma protein. Mol. Microbiol. (0950-382X) 2009 imex curation Zurawski D.V., Mumy K.L., Faherty C.S., McCormick B.A., Maurelli A.T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zurawski D.V., Mumy K.L., Faherty C.S., McCormick B.A., Maurelli A.T. Accepted 2013-FEB-01 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 ospf_shifl Phosphothreonine lyase OspF ospF mkaD Effector protein OspF pWR501_0013 SFLP011 CP0010 protein protein shifl Shigella flexneri MPIKKPCLKLNLDSLNVVRSEIPQMLSANERLKNNFNILYNQIRQYPAYYFKVASNVPTYSDICQSFSVMYQGFQIVNHSGDVFIHACRENPQSKGDFVGDKFHISIAREQVPLAFQILSGLLFSEDSPIDKWKITDMNRVSQQSRVGIGAQFTLYVKSDQECSQYSALLLHKIRQFIMCLESNLLRSKIAPGEYPASDVRPEDWKYVSYRNELRSDRDGSERQEQMLREEPFYRLMIE 75F6EA2D6FFD002A q6xw12_shifl ospB protein protein shifl Shigella flexneri MNLDGVRPYCRTVNKKNESISDIAFAHIIKRVKNSSCTHPKAALVFLGEKGFCDSNDVLSIMGQQIPRVFKNKMLYDYVFKNEKSKNDFLKMAESWLPQSEPIVINNDDDALNAAAYFSVKKAKIKTVNDTDFKEYNKVYILGHGSPGSHQLGLGSELIDVQTIISRMKDCGILNVKDIRFTSCGSADKVAPKNFNNAPAESLSCILNSLPFFKEKESLLEQIKKHLENDESLSDGLKISGYHGYGVHYGQELFPYSHYRSTSIPADPEHTVKRSSQKKTFIINKELD DF1998F80ABFCA40 ospb-rb1 1 2 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 8A ospf-rb 1 2 unspecified role unspecified role prey prey region P06400-701-928 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait Q8VSP9:p.[Ile178Arg;Cys180Gly;Glu182Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I R certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain E A Wed May 02 14:57:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile178arg,cys180gly,glu182ala' Tue Jun 30 19:29:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile178Arg;Cys180Gly;Glu182Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 11 15 direct interaction direct interaction Fig. 8B ospf-rb1 1 2 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 8A