mpidb The Microbial Protein Interaction Database Spatial clustering of the curlin secretion lipoprotein requires curli fiber assembly. Spatial clustering of the curlin secretion lipoprotein requires curli fiber assembly. J. Bacteriol. (0021-9193) 2009 imex curation Epstein E.A., Reizian M.A., Chapman M.R. Only protein-protein interactions ecoli Escherichia coli (strain K12) comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Epstein E.A., Reizian M.A., Chapman M.R. Accepted 2013-FEB-01 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation csgg_ecoli Curli production assembly/transport component CsgG JW1020 b1037 csgG protein protein ecoli Escherichia coli (strain K12) MQRLFLLVAVMLLSGCLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKAERQNDILVKYRHMSVPPES DIP protein P0AEA2 original sequence version: 65 F2DA333BD392F78E csgg-csgg-1 1 2 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component physical association physical association figure 5