UniProt UniProt http://www.uniprot.org A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. Plant Cell (1040-4651) 2008 imex curation Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. Plant Cell (1040-4651) 2008 imex curation Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. Plant Cell (1040-4651) 2008 imex curation Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. A heterocomplex of iron superoxide dismutases defends chloroplast nucleoids against oxidative stress and is essential for chloroplast development in Arabidopsis. Plant Cell (1040-4651) 2008 imex curation Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Myouga F., Hosoda C., Umezawa T., Iizumi H., Kuromori T., Motohashi R., Shono Y., Nagata N., Ikeuchi M., Shinozaki K. sinozaki@rtc.riken.jp Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation sodf2_arath Superoxide dismutase [Fe] 2, chloroplastic FSD2 APG8 Protein ALBINO OR PALE GREEN 8 Protein FE SUPEROXIDE DISMUTASE 2 MWD22.4 At5g51100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMNVAVTATPSSLLYSPLLLPSQGPNRRMQWKRNGKRRLGTKVAVSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDALSLEEVVLLSYNKGNMLPAFNNAAQAWNHEFFWESIQPGGGGKPTGELLRLIERDFGSFEEFLERFKSAAASNFGSGWTWLAYKANRLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWEHAYYLDFENRRAEYINTFMEKLVSWETVSTRLESAIARAVQREQEGTETEDEENPDDEVPEVYLDSDIDVSEVD 6A68EAF701EA5AC2 sodf3_arath Superoxide dismutase [Fe] 3, chloroplastic Protein FE SUPEROXIDE DISMUTASE 3 FSD3 MKD15.17 At5g23310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSCVVTTSCFYTISDSSIRLKSPKLLNLSNQQRRRSLRSRGGLKVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQPGGGDTPQKGVLEQIDKDFGSFTNFREKFTNAALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIICVDVWEHSYYLDYKNDRAKYINTFLNHLVSWNAAMSRMARAEAFVNLGEPNIPIA 33B1BBDEC9EF0B0C sodf1_arath Superoxide dismutase [Fe] 1, chloroplastic FSD1 Protein FE SUPEROXIDE DISMUTASE 1 SODB F13M23.240 At4g25100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKFYEEFNAAAATQFGAGWAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLVSWEAVSARLEAAKAASA BCFDA057F040F9DD fsd1-fsd1 3 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 6A fsd3-fsd2 3 5 unspecified role unspecified role prey prey mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain 6 unspecified role unspecified role bait bait mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association Fig. 6A fsd2-fsd3 3 6 unspecified role unspecified role prey prey mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain 5 unspecified role unspecified role bait bait mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association Fig. 6A fsd2-fsd3-1 4 6 unspecified role unspecified role prey prey c-term ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait c-term flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6B fsd3-fsd2-1 4 5 unspecified role unspecified role prey prey c-term ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait c-term flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6B fsd2-fsd3-2 2 5 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6C fsd2-fsd3-3 2 6 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6C fsd3-fsd2-2 1 6 unspecified role unspecified role bait bait mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Supplemental Fig. 6B fsd3-fsd3-1 3 6 unspecified role unspecified role bait bait mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain 6 unspecified role unspecified role prey prey mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association Fig. 6A fsd3-fsd1 3 6 unspecified role unspecified role bait bait mature protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Fig. 6A