mpidb The Microbial Protein Interaction Database Characterization of the putative type III secretion ATPase CdsN (Cpn0707) of Chlamydophila pneumoniae. Characterization of the putative type III secretion ATPase CdsN (Cpn0707) of Chlamydophila pneumoniae. J. Bacteriol. (0021-9193) 2008 imex curation Stone C.B., Johnson D.L., Bulir D.C., Gilchrist J.D., Mahony J.B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Stone C.B., Johnson D.L., Bulir D.C., Gilchrist J.D., Mahony J.B. Accepted 2013-JAN-28 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation Characterization of the putative type III secretion ATPase CdsN (Cpn0707) of Chlamydophila pneumoniae. Characterization of the putative type III secretion ATPase CdsN (Cpn0707) of Chlamydophila pneumoniae. J. Bacteriol. (0021-9193) 2008 imex curation Stone C.B., Johnson D.L., Bulir D.C., Gilchrist J.D., Mahony J.B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Stone C.B., Johnson D.L., Bulir D.C., Gilchrist J.D., Mahony J.B. Accepted 2013-JAN-28 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation Characterization of the putative type III secretion ATPase CdsN (Cpn0707) of Chlamydophila pneumoniae. Characterization of the putative type III secretion ATPase CdsN (Cpn0707) of Chlamydophila pneumoniae. J. Bacteriol. (0021-9193) 2008 imex curation Stone C.B., Johnson D.L., Bulir D.C., Gilchrist J.D., Mahony J.B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Stone C.B., Johnson D.L., Bulir D.C., Gilchrist J.D., Mahony J.B. Accepted 2013-JAN-28 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation q9z7j3_chlpn BN1224_CV15_C_01820 BN1224_GiD_A_07410 BN1224_H12_EO_00180 BN1224_MUL2216_F_02630 BN1224_PB1_B_07290 BN1224_Panola_K_00370 BN1224_U1271_C_05710 BN1224_Wien2_G_03680 BN1224_YK41_BR_01590 CWL029c_E_00360 CP_0034 CPn_0712 protein protein chlpn chlpn Chlamydophila pneumoniae MAVRLIVDEGPLSGVIFVLEDGISWSIGRDSSANDIPIEDPKLGASQAIINKTDGSYYITNLDDTIPIVVNGVAIQETTQLKNEDTILLGSNQYSFLSDEFDPQDLVYDFDIPEENFSNDSGDLSDSNEQGKDLEPRQTSETNHSPKPKEKLTKDQGSSDPITSGDQELADAFLASAKAEKNQPRAKVAKKGLKESSNESLNPKEQNAKDSPKGEERTNKPQNAIMEDNGASPRQDPQPKSAEPSLKNTARDETPLKENKPVEEKANKKATPDSPEKKDQPEEGSKKEGSKIEATPLDSQKESEDKEAEEAFVQEEEENLTEDNKEDSDSAADANDDTASDHTAEDNKETPKKVENEKSAVLSPFHVQDLFRFDQTIFPAEIDDIAKKNISVDLTQPSRFLLKVLAGANIGAEFHLDSGKTYILGTDPTTCDIVFNDLSVSHQHAKITVGNDGGILIEDLDSKNGVIVEGRKIDKTSTLSSNQVVALGTTLFLLIDHHAPADTIVASLSPDDYSLFGRQQDAEALERQEAQEEEEKQKRATLPAGSFILTLFVGGLAILFGIGTASLFHTKEVVPLENIDYQEDLAQVINQFPTVRYTFNKTNSQLFLIGHVKNSTDKSELLYKVDALSFVKSVDDNVIDDEAVWQEMNILLSKRPEFKGISMHSPEPGKFIITGYVKTEEQAACLVDYLNIHFNYLSLLENKVVVETQMLKAIAGHLLQGGFANIHVAFVNGEVILTGYVNNDDAEKFRAVVQELSGIPGVRLVKNFAVLLPAEEGIIDLNLRYPNRYRVTGYSRYGEISINVVVNGRILTRGDVIDGMTVTSIQPNAIFLEKEGLKYKIDYNK 3C578FB8506D9754 q9z7j9_chlpn CPn0706 Homolog CPn_0706 BN1224_CV15_C_01760 BN1224_DC9_BW_00120 BN1224_GiD_A_07350 BN1224_H12_EO_00120 BN1224_MUL2216_F_02570 BN1224_PB1_B_07230 BN1224_Panola_K_00310 BN1224_U1271_C_05650 BN1224_UZG1_B_00310 BN1224_Wien2_G_03620 BN1224_YK41_BR_01530 CWL029c_E_00300 CP_0040 protein protein chlpn chlpn Chlamydophila pneumoniae MAKYPLEPVLAIKKDRVDRAEKVVKEKRRLLEIEQEKLREKEAERDKVKNHYMQKIQQLRDLLDEGTTSDAVLQIKSYIKVVAVQLSEEEEKVNKQKEVVLAASKELEKAEVNLAKRRKEEEKTRLHKEEWMKEALKEEARAEEKEQDEMGQLLFQLRQKKKRESGGS CE13216800D0FF01 q9z780_chlpn yscL BN1224_CV15_C_02970 BN1224_GiD_A_08560 BN1224_H12_EV_00050 BN1224_MUL2216_F_03780 BN1224_PB1_B_08440 BN1224_Panola_K_01510 BN1224_U1271_C_06860 BN1224_UZG1_B_01530 BN1224_Wien2_H_00720 BN1224_YK41_BX_00150 CWL029c_E_01510 CP_1045 CPn_0826 protein protein chlpn chlpn Chlamydophila pneumoniae MKFFSLIFKDDDVSPNKKVLSPEAFSAFLDAKELLEKTKADSEAYVAETEQKCAQIRQEAKDQGFKEGSESWSKQIAFLEEETKNLRIRVREALVPLAIASVRKIIGKELELHPETIVSIISQALKELTQNKHIIISVNPKDLPLVEKSRPELKNIVEYADSLILTAKPDVTPGGCIIETEAGIINAQLDVQLDALEKAFSTILKAKNPVDEPSETSSSTDSSSLSNDQDKKE 436600221E57A90A q9z7j8_chlpn Type 3 secretion system ATPase yscN CPn_0707 BN1224_CV15_C_01770 BN1224_GiD_A_07360 BN1224_H12_EO_00130 BN1224_MUL2216_F_02580 BN1224_PB1_B_07240 BN1224_Panola_K_00320 BN1224_U1271_C_05660 BN1224_UZG1_B_00320 BN1224_Wien2_G_03630 BN1224_YK41_BR_01540 CWL029c_E_00310 CP_0039 protein protein chlpn chlpn Chlamydophila pneumoniae MDQLTTDFDTLMSQLGDVNLTTVVGRITEVVGMLIKAVVPNVRVGEVCLVKRNGMEPLVTEVVGFTQSFAFLSPLGELSGVSPSSEVIPTGLPLHIRAGNGLLGRVLNGLGEPIDVETKGPLQNVDQTFPIFRAPPDPLHRAKLRQILSTGVRCIDGMLTVARGQRIGIFAGAGVGKSSLLGMIARNAEEADVNVIALIGERGREVREFIEGDLGEEGMKRSVIVVSTSDQSSQLRLNAAYVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPRLLERSGASDKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIVLSNALAQAYHYPAIDVLASISRLLTAIVPEEQRRIIGKAREVLAKYKANEMLIRIGEYRRGSDREIDFAIDHIDKLNRFLKQDIHEKTNYEEAAQQLRAIFR B1D4AB68BB6FA80A q9z8l4_chlpn lcrE CPn_0324 BN1224_CV15_B_02610 BN1224_DC9_BL_00250 BN1224_GiD_A_03370 BN1224_H12_DC_00070 BN1224_MUL2216_E_00610 BN1224_PB1_B_03230 BN1224_Panola_E_01460 BN1224_U1271_C_01640 BN1224_UZG1_A_03360 BN1224_Wien2_E_01090 BN1224_YK41_BG_00220 CWL029c_C_01640 CP_0433 protein protein chlpn chlpn Chlamydophila pneumoniae MAASGGTGGLGGTQGVNLAAVEAAAAKADAAEVVASQEGSEMNMIQQSQDLTNPAAATRTKKKEEKFQTLESRKKGEAGKAEKKSESTEEKPDTDLADKYASGNSEISGQELRGLRDAIGDDASPEDILALVQEKIKDPALQSTALDYLVQTTPPSQGKLKEALIQARNTHTEQFGRTAIGAKNILFASQEYADQLNVSPSGLRSLYLEVTGDTHTCDQLLSMLQDRYTYQDMAIVSSFLMKGMATELKRQGPYVPSAQLQVLMTETRNLQAVLTSYDYFESRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDKFPTASKVEREVRNLIGDDVDSVTGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDAVNINNEDYPKASDFPKPYPWS 92C370D1EEF458F3 q9z7k1_chlpn fliN BN1224_CV15_C_01740 BN1224_GiD_A_07330 BN1224_H12_EO_00100 BN1224_MUL2216_F_02550 BN1224_PB1_B_07210 BN1224_Panola_K_00290 BN1224_U1271_C_05630 BN1224_UZG1_B_00290 BN1224_Wien2_G_03600 BN1224_YK41_BR_01510 CWL029c_E_00280 CP_0042 CPn_0704 protein protein chlpn chlpn Chlamydophila pneumoniae MAVAADSSASWLKSRNNFLSSLGKTEEQVAAPEFPKELCQHKIREKFRLEDVQVSIKFRGSITAVEATKEFGVHLLIQPMVVQPWEVENLLFLTSEEDLQELMVAVFDDASLASYFYEKDKLLGFHYYFVAEACKLFEELQWVPSLSAKVGGDAIFTATSLQGSFQVVDISLRLDGKNVRCRLLLPEDTFQSCQKFFSGLHDESDLHNIDQTQQISLSVEVGYSQLTQEEWHQVVPGSFIMLDSCLYDPETEESGALLTVQKHQFFGGRFLTPSSGEFKITSYPNLTHEDPPLPENPQASAAPLPGYSRLVVEVARYSLAVSEFIKLNLGSILSLGNHPAYGVDIILDGAKVGRGEIIALGDVLGIRVLEV 042DAFBE7295588E yscn-cpn0706_homolog 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association yscl-1 2 6 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 3B yscn-flin 3 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 2 yscn-lcre 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 2 yscn-clpd 3 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Table 2 yscn-cpn0706_homol-1 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 6 yscn-yscn 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 36 34 physical association physical association yscn-2 2 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A yscn-cdsl 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 2 yscn-lcre-1 1 8 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 5 yscn-yscl 1 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig. 5 yscn-q9z7j3 1 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association Fig. 5 yscn-flin-1 1 9 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 5 cpn0706 homolog 2 5 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6B