UniProt UniProt http://www.uniprot.org Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Plant Physiol. (0032-0889) 2008 imex curation Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Accepted 2012-MAR-30 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Plant Physiol. (0032-0889) 2008 imex curation Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Accepted 2012-MAR-30 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Plant Physiol. (0032-0889) 2008 imex curation Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Only protein-protein interactions brasx Brassica sp. (Mustard) bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. the host organism for bifc was not in the list (NCBI_TaxID=3711) chongk@ibcas.ac.cn Accepted 2012-MAR-30 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Plant Physiol. (0032-0889) 2008 imex curation Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Accepted 2012-MAR-30 by ORCHARD Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. Plant Physiol. (0032-0889) 2008 imex curation Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Only protein-protein interactions orysj-root Rice (japonica) root root anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Accepted 2012-MAR-30 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation q9fxt8_orysj OsRPT4 Os02g0199900 OSNPB_020199900 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MADGEDAAAARRRASVTEYRKKLLNCRELESRVSTVRENLKNAKKDFTKTEDDLKSLQSVGQIIGEVLRPLDNERFIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDELGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQARMEVLKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMAAIRAERDYVVHEDFMKAVRKLNDAKKLESSAHYSADFGKE 43AD3D5088DABC37 flp1_orysj Flowering-promoting factor 1-like protein 1 RAA1 FPF1-like protein 1 Protein ROOT ARCHITECTURE ASSOCIATED 1 OsJ_01159 P0462H08.5 LOC_Os01g15340 Os01g0257300 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVSSYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRDSFRVVDA C0F5ED79788DBAFF rpt4-raa1 4 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 1A raa1-rpt4 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1B raa1-rpt4 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1C raa1-rpt4 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 2A raa1-rpt4-2 5 7 unspecified role unspecified role unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined orysj Oryza sativa subsp. japonica (Rice) Rice 6 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined orysj Oryza sativa subsp. japonica (Rice) Rice physical association physical association Fig. 2B raa1-rpt4 3 7 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2D