mpidb The Microbial Protein Interaction Database Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Mol. Microbiol. (0950-382X) 2008 imex curation Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions rhime Rhizobium meliloti Sinorhizobium meliloti fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Accepted 2013-JAN-18 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Mol. Microbiol. (0950-382X) 2008 imex curation Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Accepted 2013-JAN-18 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Mol. Microbiol. (0950-382X) 2008 imex curation Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Accepted 2013-JAN-18 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. Mol. Microbiol. (0950-382X) 2008 imex curation Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Accepted 2013-JAN-18 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation chea_rhime Chemotaxis protein CheA SMc03007 R00639 cheA protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MDMNEIKEIFFQECEEQLAELESGLLKLNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLRSADVLADLTNAARDGGGVDEARSRQLIKELEALANGELPQAAAESAPKTTPAGVAPAAPVVNEEGFQPVAFSFDDFETGDEPTIEPSTYEIVFKPKSDLYSKGNDATLLLRDLSRLGEMSIHCNMDTLPPLDRMNPEEAYFSWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGTVGMDEDLPMQPVPFDLSILEDEAQAPAGEEDRAAASEGDSRNAAVAAAQTASNVLQMAQSTARVSPENARNSQSASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLITEGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRIVIELADDGAGINREKVRQKAIDNDLIAADANLSDEEVDNLIFHAGFSTADKISDISGRGVGMDVVKRSIQALGGRINISSKPGQGSIFTMSLPLTLAVLDGMVVTVANQTLVVPLTAIVETLQPEASAIHSFGSSQRLISIRDSFCPLVDVGRILNFRGAQANPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQSLKPEMSLAAAG 9F03A8F24EA25D5D q52884_rhiml CDO24_06225 CN171_21380 CN211_06630 GHK53_05465 cheY2 CEJ86_01705 CN070_16445 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK B85665853BDDC453 chea-chey2 1 5 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 2 chea-chey2-3 2 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction Fig. 2 chea-chey2-5 4 6 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Fig. 4 chey2-chea 3 6 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Fig. 4