mpidb The Microbial Protein Interaction Database Suppression of a cold-sensitive mutation in ribosomal protein S5 reveals a role for RimJ in ribosome biogenesis. Suppression of a cold-sensitive mutation in ribosomal protein S5 reveals a role for RimJ in ribosome biogenesis. Mol. Microbiol. (0950-382X) 2008 imex curation Roy-Chaudhuri B., Kirthi N., Kelley T., Culver G.M. no rs4 only used as marker for presence of entire ribosomal particle 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Roy-Chaudhuri B., Kirthi N., Kelley T., Culver G.M. no rs4 only used as marker for presence of entire ribosomal particle Accepted 2013-JAN-17 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation rimj_ecoli [Ribosomal protein S5]-alanine N-acetyltransferase Acetylating enzyme for N-terminal of ribosomal protein S5 rimJ b1066 JW1053 protein protein ecoli Escherichia coli (strain K12) MFGYRSNVPKVRLTTDRLVVRLVHDRDAWRLADYYAENRHFLKPWEPVRDESHCYPSGWQARLGMINEFHKQGSAFYFGLFDPDEKEIIGVANFSNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQWRDHVLTALTTPDWTPGR 1DCC58BD1C06AB61 rs4_ecoli 30S ribosomal protein S4 rpsD ramA b3296 JW3258 Small ribosomal subunit protein uS4 protein protein ecoli Escherichia coli (strain K12) MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAEQREKPTWLEVDAGKMEGTFKRKPERSDLSADINEHLIVELYSK DIP protein P0A7V8 original sequence version: 59 4015969DF8E582BB rimj-rpsd 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5C