mpidb The Microbial Protein Interaction Database YscU cleavage and the assembly of Yersinia type III secretion machine complexes. YscU cleavage and the assembly of Yersinia type III secretion machine complexes. Mol. Microbiol. (0950-382X) 2008 imex curation Riordan K.E., Schneewind O. Only protein-protein interactions yeren Yersinia enterocolitica pull down pull down western blot western blot Immuno blot Immuno blot Riordan K.E., Schneewind O. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation YscU cleavage and the assembly of Yersinia type III secretion machine complexes. YscU cleavage and the assembly of Yersinia type III secretion machine complexes. Mol. Microbiol. (0950-382X) 2008 imex curation Riordan K.E., Schneewind O. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Riordan K.E., Schneewind O. Accepted 2013-FEB-06 by ORCHARD Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation ysck_yeren Yop proteins translocation protein K yscK protein protein yeren Yersinia enterocolitica MMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLNAALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQLLTLVNQETLRQIIVQHELLIGPWPTNWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQAWCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVMPTCSHLFK 05FBDC449AABA988 sctn_yeren Type 3 secretion system ATPase sctN Type III secretion ATPase Yop proteins secretion ATPase Ysc ATPase yscN protein protein yeren Yersinia enterocolitica MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIGELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLLGQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQRMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLVVATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTRRGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSRKLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQDKEADQAIERIGAIRGWLCQGTHELSHFNETLNLLETLTQ DIP protein P40290 original sequence version: 94 7CAE9B444127D07A q9za78_yeren yscQ protein protein YEREN_W22703 Yersinia enterocolitica W22703 MSLLTLPQAKLSELSLRQRLSHYRQNYLWEEGKLELTVSEPPSSLNCILQLQWKGTHFTLYCFGDDLANWLTPDLLGAPFSTLPKELQLALLERQTVFLPKLVCNDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILLSLRWHKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHESDELNPKPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRLLGHGRLVEIQGRLGVRIERLTEVTIS 24078E7F4EAFE2A0 sctl_yeren Type 3 secretion system stator protein sctL Yop proteins translocation protein L yscL protein protein yeren Yersinia enterocolitica MSQTCQTGYAYMQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEKILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVRKILNDYDQVDMTLQVVREALALVSNQKQVVVRVNPDQAGTIREQIAKVHKDFPEISYLEVTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTEEE 4B64F681A5819D47 q56844_yeren yscU protein protein YEREN_W22703 Yersinia enterocolitica W22703 MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTTLIVALSAMLMGLSDYYFEHLSRLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML 0F4D709DF2FCB9D4 q93kt7_yeren yscO ERS008652_03718 protein protein yeren Yersinia enterocolitica MIRRLHRVKVLRVERAEQAIKTQQACLQAAHRRHQEAVQTSQDYHLWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERLTSCQKTLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA 101FD2070DA44B51 yscu-ysck-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association Fig. 5C yscu-yscl-2 2 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q56844:p.Gly270Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G N Wed May 02 20:17:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly270asn' Tue Jun 30 19:22:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly270Asn' ecolx Escherichia coli direct interaction direct interaction Fig. 7 yscu-ysck 2 3 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeren Yersinia enterocolitica direct interaction direct interaction Fig. 8B yscu-yscq 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q56844:p.Asn263Ala mutation mutation certain certain sequence position certain certain certain sequence position certain N A Wed May 02 17:56:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn263ala' Tue Jun 30 19:06:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn263Ala' association association Fig. 6 yscu-yscl-3 1 7 unspecified role unspecified role bait bait Q56844:p.Gly270Asn mutation mutation certain certain sequence position certain certain certain sequence position certain G N Wed May 02 18:02:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly270asn' Tue Jun 30 15:57:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly270Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association Fig. 7 yscu-yscn 2 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeren Yersinia enterocolitica direct interaction direct interaction Fig. 8B yscu-yscq-1 2 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Fig. 8B