mpidb The Microbial Protein Interaction Database Fold and function of polypeptide transport-associated domains responsible for delivering unfolded proteins to membranes. Fold and function of polypeptide transport-associated domains responsible for delivering unfolded proteins to membranes. Mol. Microbiol. (0950-382X) 2008 imex curation Knowles T.J., Jeeves M., Bobat S., Dancea F., McClelland D., Palmer T., Overduin M., Henderson I.R. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecow3 Escherichia coli (strain K12 / W3110 / ATCC 27325 / DSM 5911) nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Knowles T.J., Jeeves M., Bobat S., Dancea F., McClelland D., Palmer T., Overduin M., Henderson I.R. Accepted 2013-JAN-16 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation phoe_ecoli Outer membrane porin PhoE phoE ompE b0241 JW0231 Outer membrane pore protein E protein protein ecoli Escherichia coli (strain K12) MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF DIP protein P02932 original sequence version: 146 DIP protein P02932 original sequence version: null 249E2E362C030C9A bama_ecoli Outer membrane protein assembly factor BamA bamA Omp85 yaeT yzzN yzzY JW0172 b0177 protein protein ecoli Escherichia coli (strain K12) MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW DIP protein P0A940 original sequence version: 84 DIP protein P0A940 original sequence version: 102 DIP protein P0A940 original sequence version: 103 DDCE4C6D341664EB bama-phoe 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role neutral component neutral component region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction