mpidb The Microbial Protein Interaction Database Identification of amino acid residues within the N-terminal domain of EspA that play a role in EspA filament biogenesis and function. Identification of amino acid residues within the N-terminal domain of EspA that play a role in EspA filament biogenesis and function. J. Bacteriol. (0021-9193) 2008 imex curation Singh M.P., Shaw R.K., Knutton S., Pallen M.J., Crepin V.F., Frankel G. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Singh M.P., Shaw R.K., Knutton S., Pallen M.J., Crepin V.F., Frankel G. Accepted 2013-JAN-08 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation b7um94_eco27 espA E2348C_3936 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MDTSTTASVASANASTSTSMAYDLGSMSKDDVIDLFNKLGVFQAAILMFAYMYQAQSDLSIAKFADMNEASKESTTAQKMANLVDAKIADVQSSSDKNAKAQLPDEVISYINDPRNDITISGIDNINAQLGAGDLQTVKAAISAKANNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISLGK 0F007C23E5E39BF1 o52124_ecolx BFL24_25155 DAH23_17650 cesAB orf3 BON63_23780 C9E67_00525 L537_062 LDEC_054 LIHIT_058 UN91_09460 protein protein ecolx Escherichia coli MSIVSQTRNKELLDKKIRSEIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRNRNNRKIV 9B3FFBA7C8D448CE espa-orf3-2 1 2 unspecified role unspecified role bait bait B7UM94:p.Phe49Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F R Wed May 02 18:46:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49arg' Tue Jun 30 17:27:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe49Arg' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined B7UM94:p.Phe42Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F R Wed May 02 19:35:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe42arg' Tue Jun 30 16:04:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe42Arg' B7UM94:p.Ile46Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I R Wed May 02 18:58:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile46arg' Tue Jun 30 18:00:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile46Arg' 3 unspecified role unspecified role prey prey physical association physical association Fig. 4B