UniProt UniProt http://www.uniprot.org Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Mol. Cell. Biol. (0270-7306) 2008 imex curation Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk Accepted 2012-FEB-15 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Mol. Cell. Biol. (0270-7306) 2008 imex curation Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk Accepted 2012-FEB-15 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Mol. Cell. Biol. (0270-7306) 2008 imex curation Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk Accepted 2012-FEB-15 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. Mol. Cell. Biol. (0270-7306) 2008 imex curation Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Taylor E.M., Copsey A.C., Hudson J.J., Vidot S., Lehmann A.R. a.r.lehmann@sussex.ac.uk Accepted 2012-FEB-15 by ORCHARD Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation nse3_human Non-structural maintenance of chromosomes element 3 homolog HCA4 Hepatocellular carcinoma-associated protein 4 MAGE-G1 antigen MAGEG1 Melanoma-associated antigen G1 NDNL2 Necdin-like protein 2 NSMCE3 protein protein human Homo sapiens Human MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS C00E2FB2D2CCED7B nse4a_human Non-structural maintenance of chromosomes element 4 homolog A NSMCE4A C10orf86 PP4762 protein protein human Homo sapiens Human MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEPSDSGDEMMDPASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTLFNEVSRAREAVLDAHFLVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENTFNKTHTFHFLLGSIYGECPVPKPRVDRPRKVPVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFREDPDTPMSFFDFVVDPHSFPRTVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQGIIALSYRDWEEIVKTFEISEPVITPSQRQQKPSA 8BB8C54C8A6D0A1E eid3_human EP300-interacting inhibitor of differentiation 3 EID-1-like inhibitor of differentiation 3 E1A-like inhibitor of differentiation 3 EID3 Non-structural maintenance of chromosomes element 4 homolog B protein protein human Homo sapiens Human MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVSSANNSLTEALEEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFCDFLFLFVGLNWMEGDPDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRLPILEPMNVNQMGEGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITYSSY 3B35D08977C47C5A smc5_human Structural maintenance of chromosomes protein 5 SMC5 KIAA0594 SMC5L1 protein protein human Homo sapiens Human MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSRGMVEIELFRASGNLVITREIDVAKNQSFWFINKKSTTQKIVEEKVAALNIQVGNLCQFLPQDKVGEFAKLSKIELLEATEKSIGPPEMHKYHCELKNLREKEKQLETSCKEKTEYLQKMVQRNERYKQDVERFYERKRHLDLIEMLEAKRPWVEYENVRQEYEEVKLVRDRVKEEVRKLKEGQIPVTCRIEEMENERHNLEARIKEKATDIKEASQKCKQKQDVIERKDKHIEELQQALIVKQNEELDRQRRIGNTRKMIEDLQNELKTTENCENLQPQIDAITNDLRRIQDEKALCEGEIIDKRRERETLEKEKKSVDDHIVRFDNLMNQKEDKLRQRFRDTYDAVLWLRNNRDKFKQRVCEPIMLTINMKDNKNAKYIENHIPSNDLRAFVFESQEDMEVFLKEVRDNKKLRVNAVIAPKSSYADKAPSRSLNELKQYGFFSYLRELFDAPDPVMSYLCCQYHIHEVPVGTEKTRERIERVIQETRLKQIYTAEEKYVVKTSFYSNKVISSNTSLKVAQFLTVTVDLEQRRHLEEQLKEIHRKLQAVDSGLIALRETSKHLEHKDNELRQKKKELLERKTKKRQLEQKISSKLGSLKLMEQDTCNLEEEERKASTKIKEINVQKAKLVTELTNLIKICTSLHIQKVDLILQNTTVISEKNKLESDYMAASSQLRLTEQHFIELDENRQRLLQKCKELMKRARQVCNLGAEQTLPQEYQTQVPTIPNGHNSSLPMVFQDLPNTLDEIDALLTEERSRASCFTGLNPTIVQEYTKREEEIEQLTEELKGKKVELDQYRENISQVKERWLNPLKELVEKINEKFSNFFSSMQCAGEVDLHTENEEDYDKYGIRIRVKFRSSTQLHELTPHHQSGGERSVSTMLYLMALQELNRCPFRVVDEINQGMDPINERRVFEMVVNTACKENTSQYFFITPKLLQNLPYSEKMTVLFVYNGPHMLEPNTWNLKAFQRRRRRITFTQPS 54393D50688A914A nse2_human E3 SUMO-protein ligase NSE2 NSMCE2 C8orf36 MMS21 Non-structural maintenance of chromosomes element 2 homolog MMS21 homolog E3 SUMO-protein transferase NSE2 protein protein human Homo sapiens Human MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE 24D945C8F16F58F8 nse1_human Non-structural maintenance of chromosomes element 1 homolog NSMCE1 HSPC333 HSPC337 protein protein human Homo sapiens Human MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH 58A3C2AF70FC8F39 smc6_human Structural maintenance of chromosomes protein 6 SMC6 SMC6L1 protein protein human Homo sapiens Human MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADISITLRNRGDDAFKASVYGNSILIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSYIMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAWAVVNEIEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALKADVVAKKRAYNEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAFQNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRPPIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPPKNCREAFTADGDQVFAGRYYSSENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNEELLKRCQLHYKELKMKIRKNISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLKSLKIEAENKYDAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKEKELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARETYLDLDSKVRTLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNETLSISVQPGEGNKAAFNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVNRRIAMDLILKMADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQEEDDDQR 03C6F478E34285E6 smc6-nsmce1 4 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1C nsmce1-smc6 4 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1C smc6-nsmce2 4 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1E nsmce1-nsmce2 4 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 1E nsmce4a-nsmce1 2 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2B eid3-nsmce1 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey association association 2C ndnl2-nsmce1 2 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2D nse1-ndnl2 3 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Table I smc6-ndnl2-1 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association Table I smc6-ndnl2-2 4 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 3A ndnl2-nsmce1-1 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association 3B nsmce1-smc6-1 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association 3A