mpidb The Microbial Protein Interaction Database Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Mol. Microbiol. (0950-382X) 2008 imex curation Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. Accepted 2013-JAN-07 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Mol. Microbiol. (0950-382X) 2008 imex curation Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. Accepted 2013-JAN-07 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Mol. Microbiol. (0950-382X) 2008 imex curation Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. Accepted 2013-JAN-07 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Mol. Microbiol. (0950-382X) 2008 imex curation Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. Accepted 2013-JAN-07 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Mol. Microbiol. (0950-382X) 2008 imex curation Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. Accepted 2013-JAN-07 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation. Mol. Microbiol. (0950-382X) 2008 imex curation Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S. Accepted 2013-JAN-07 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation afae3_ecolx Afimbrial adhesin AFA-III afaE3 afaE-3 protein protein ecolx Escherichia coli MKKLAIMAAASMVFAVSSAHAGFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWAK D5228F367A9D0275 ceam5_human Carcinoembryonic antigen-related cell adhesion molecule 5 CEACAM5 CEA Carcinoembryonic antigen Meconium antigen 100 protein protein human Homo sapiens Human MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI DIP protein P06731 original sequence version: 110 86318E244155DB58 q7bg35_ecolx draE protein protein ecolx Escherichia coli MKKLAIMAAASMVFAVSSAHAGFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK 8F282F8FF1500788 ceacam5-ceacam5-1 1 8 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Table1 1.95A Rworking = 0.18 Rfree = 0.2 afae3-ceacam5 5 8 unspecified role unspecified role neutral component neutral component P06731:p.Leu52Ser mutation mutation certain certain sequence position certain certain certain sequence position certain L S Wed May 02 15:39:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu52ser' Tue Jun 30 20:23:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu52Ser' P06731:p.Leu54Thr mutation mutation certain certain sequence position certain certain certain sequence position certain L T Wed May 02 20:01:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu54thr' Tue Jun 30 20:02:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu54Thr' 7 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 4 ceacam5-ceacam5 1 8 unspecified role unspecified role neutral component neutral component P06731:p.Val73Cys mutation mutation certain certain sequence position certain certain certain sequence position certain V C Wed May 02 18:51:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val73cys' Tue Jun 30 16:22:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val73Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Table 1 2.9A Rworking = 0.22 Rfree = 0.25 ceacam5-2 2 8 unspecified role unspecified role neutral component neutral component P06731:p.Gln78Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 19:41:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln78leu' Tue Jun 30 17:42:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln78Leu' P06731:p.Gln78Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 15:30:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln78arg' Tue Jun 30 18:54:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln78Arg' P06731:p.Ser66Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S N Wed May 02 19:42:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser66asn' Tue Jun 30 19:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser66Asn' P06731:p.Tyr68Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:29:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr68ala' Tue Jun 30 19:44:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr68Ala' P06731:p.Ile125Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 17:33:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile125ala' Tue Jun 30 16:16:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile125Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P06731:p.Phe63Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F R Wed May 02 17:28:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe63arg' Tue Jun 30 15:52:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe63Arg' P06731:p.Leu129Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L S Wed May 02 15:40:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu129ser' Tue Jun 30 19:01:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu129Ser' P06731:p.Glu133Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 19:19:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu133ala' Tue Jun 30 16:14:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu133Ala' ecolx Escherichia coli direct interaction direct interaction Supp. Fig.1, Table 2 ceacam5-ceacam5-2 3 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P06731:p.Val73Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V A Wed May 02 16:09:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val73ala' Tue Jun 30 17:31:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val73Ala' ecolx Escherichia coli direct interaction direct interaction 3 ceacam5-2 4 8 unspecified role unspecified role neutral component neutral component P06731:p.Phe63Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F R Wed May 02 18:45:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe63arg' Tue Jun 30 17:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe63Arg' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P06731:p.Leu129Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L S Wed May 02 19:25:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu129ser' Tue Jun 30 18:37:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu129Ser' P06731:p.Gln78Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:43:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln78leu' Tue Jun 30 18:38:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln78Leu' P06731:p.Ile125Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 19:22:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile125ala' Tue Jun 30 16:19:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile125Ala' P06731:p.Tyr68Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:06:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr68ala' Tue Jun 30 17:40:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr68Ala' P06731:p.Ser66Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S N Wed May 02 14:49:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser66asn' Tue Jun 30 18:09:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser66Asn' P06731:p.Glu133Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:53:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu133ala' Tue Jun 30 20:15:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu133Ala' ecolx Escherichia coli direct interaction direct interaction Supp. Fig.1, Table 2 1.95A Rworking = 0.18 Rfree = 0.2 ceacam5-2 6 8 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P06731:p.Val73Cys mutation mutation certain certain sequence position certain certain certain sequence position certain V C Wed May 02 16:02:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val73cys' Tue Jun 30 19:27:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val73Cys' ecolx Escherichia coli direct interaction direct interaction Fig. 4A ceacam5-drae 3 8 unspecified role unspecified role bait bait P06731:p.Val73Cys mutation mutation certain certain sequence position certain certain certain sequence position certain V C Wed May 02 16:28:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val73cys' Tue Jun 30 16:58:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val73Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey direct interaction direct interaction Fig4C-E DTT DraE appears to disrupt N-CEA dimers prior to binding to the resulting monomer.