mpidb The Microbial Protein Interaction Database Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. J. Bacteriol. (0021-9193) 2008 imex curation Wicker-Planquart C., Foucher A.E., Louwagie M., Britton R.A., Jault J.M. catherine.wicker-planquart@ibs.fr 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Wicker-Planquart C., Foucher A.E., Louwagie M., Britton R.A., Jault J.M. catherine.wicker-planquart@ibs.fr Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. J. Bacteriol. (0021-9193) 2008 imex curation Wicker-Planquart C., Foucher A.E., Louwagie M., Britton R.A., Jault J.M. catherine.wicker-planquart@ibs.fr 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wicker-Planquart C., Foucher A.E., Louwagie M., Britton R.A., Jault J.M. catherine.wicker-planquart@ibs.fr Accepted 2013-JAN-04 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation rl10_bacsu 50S ribosomal protein L10 BL5 Cold acclimatization protein Vegetative protein 300 BSU01040 rplJ protein protein bacsu Bacillus subtilis MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEEQGA 82A1D4A155C7F26A rl23_bacsu 50S ribosomal protein L23 rplW BSU01180 protein protein bacsu Bacillus subtilis MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA 54272FBD14393AD6 engb_bacsu Probable GTP-binding protein EngB engB ysxC BSU28190 protein protein bacsu Bacillus subtilis MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR 12EC561C1806FFE3 rl1_bacsu 50S ribosomal protein L1 rplA BSU01030 protein protein bacsu Bacillus subtilis MAKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDATVEVAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKIQQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEYRVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKVDSSTFNVK FE3880DD4E25AB43 rl7_bacsu 50S ribosomal protein L7/L12 BL9 Vegetative protein 341 BSU01050 rplL protein protein bacsu Bacillus subtilis MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGAAAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGASVEVK 8BFE1B168292FAEC rl27_bacsu 50S ribosomal protein L27 BL24 BL30 BSU27940 rpmA protein protein bacsu Bacillus subtilis MLRLDLQFFASKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGTVKFERFGRDRKKVSVYPVAQ AFB2D90836B6AABD rl3_bacsu 50S ribosomal protein L3 rplC BSU01160 protein protein bacsu Bacillus subtilis MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDGYEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK 44A0FDF6F3C681AB rl6_bacsu 50S ribosomal protein L6 BL10 BSU01310 rplF protein protein bacsu Bacillus subtilis MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK C52DC1D1543E377E engb-rpla-2 1 5 unspecified role unspecified role bait bait ecolx Escherichia coli 6 unspecified role unspecified role prey prey bacsu Bacillus subtilis 9 unspecified role unspecified role prey prey bacsu Bacillus subtilis physical association physical association Table 1 engb-rpla-3 1 9 unspecified role unspecified role prey prey bacsu Bacillus subtilis 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey bacsu Bacillus subtilis physical association physical association Table 1 engb-rplf-1 1 3 unspecified role unspecified role prey prey bacsu Bacillus subtilis 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey bacsu Bacillus subtilis physical association physical association Table 1 engb-rplf-2 2 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 7 engb-rpll-1 1 4 unspecified role unspecified role prey prey bacsu Bacillus subtilis 8 unspecified role unspecified role prey prey bacsu Bacillus subtilis 7 unspecified role unspecified role prey prey bacsu Bacillus subtilis 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Table 1 engb-rpll-2 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 7 engb-rpla-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 7