UniProt UniProt http://www.uniprot.org p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. J. Cell. Biochem. (0730-2312) 2008 imex curation Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions rat-umr-106 Rattus norvegicus umr-106 Rat UMR-106 osteosarcoma cell line tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu Accepted 2012-MAY-22 by PPORRAS J. Cell. Biochem. (0730-2312) 2008 Only protein-protein interactions imex curation p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. J. Cell. Biochem. (0730-2312) 2008 imex curation Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions rat-umr-106 Rattus norvegicus umr-106 Rat UMR-106 osteosarcoma cell line tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu Accepted 2012-MAY-22 by PPORRAS 20-Jun-2012: Contacted by JYOTI. J. Cell. Biochem. (0730-2312) 2008 Only protein-protein interactions imex curation p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. J. Cell. Biochem. (0730-2312) 2008 imex curation Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions rat-ros17/2.8 Rattus norvegicus ROS17/2.8 osteosarcoma cell line ros17/2.8 ROS 17/2.8 osteosarcoma cell line confocal microscopy confocal microscopy immunostaining immunostaining Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu Accepted 2012-MAY-22 by PPORRAS 20-Jun-2012: Contacted by JYOTI. J. Cell. Biochem. (0730-2312) 2008 Only protein-protein interactions imex curation p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. J. Cell. Biochem. (0730-2312) 2008 imex curation Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu Accepted 2012-MAY-22 by PPORRAS 20-Jun-2012: Contacted by JYOTI. J. Cell. Biochem. (0730-2312) 2008 Only protein-protein interactions imex curation p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. J. Cell. Biochem. (0730-2312) 2008 imex curation Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast confocal microscopy confocal microscopy immunostaining immunostaining Jensen E.D., Niu L., Caretti G., Nicol S.M., Teplyuk N., Stein G.S., Sartorelli V., van Wijnen A.J., Fuller-Pace F.V., Westendorf J.J. Origin of Runx 2 according to following: mouse runx2 isoform used in GST- pull down fig 3e (deduced from seq length). Stated RT-PCR from mouse cells. For TAP-Runx2 stated they used a 'MRIPV isoform" which could correspond to human Q13950-2, or mouse Q08775-3 or Q08775-4 in UniProt. Consequently mouse origin was chosen. Origin of p68 constructs according pmid 10837141 (stated that constructs have been provided by Janknecht R. who used GST-p68 in pmid 12527917 stating there that the clone derived from Fuller-Pace F.V. (who worked with human, see 10837141 for cDNA cloning). westendorf.jennifer@mayo.edu Accepted 2012-MAY-22 by PPORRAS 20-Jun-2012: Contacted by JYOTI. J. Cell. Biochem. (0730-2312) 2008 Only protein-protein interactions imex curation lima1_rat LIM domain and actin-binding protein 1 Epithelial protein lost in neoplasm Lima1 eplin protein protein rat Rattus norvegicus (Rat) Rat MESTPFNRRQWTSLSLRVTAKELSLVNKNKSSTIVEIFSKYQKAAEEANMERKKNNTESLPQHFRRGTLSVLKKKWENPVAGAESHTDSLPNSSSDGGHTADHPPAEVTAKAAPGARADREEHTQPRSRFGSRPEAVTQCRYPRSEDSHDFKAQATESQNMENCLGDSRHEAEKPEMSENTETSGKIEKYNVPLNRLKMMFEKGEHSQNKSPWTQGRNAGGRRLSENSCSLDDLEIGAGHLSSSAFNSEKNESKRNLELPRLSETSIKDRMAKYQAAVSKQSSPASYASELKPSESKTHKWEQKENVPPGPEACSIHQEGSKVSATENSLVAHPVPAEDDTCNSQGRSEAQQPIYTKPLSPDARTSSLPESSPSKTAKKFQAPARESCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHKQHKDLWASKGENEETLGRPAQPPSAGETPHSPGVEDAPIAKVGVLAASMEAKASSQREREENKPAETKKLRIAWPPPAEQGSSGSAPEEGFKVSKPKWPPEDEVCKTEAPEDVDLDLKKLRRSSSLKERSRPFTVAASFRTSSVKSPKPLSPSLRKGWSEPEPEQSEEFGGGTVTQTESPRPSREKESVGKSRWQSEEAEAEAEEAPRGRDGRSFELESESFIGNGASIAEDDVAPAQRSPLEPESPGWPGFGDTTTAKEFNQKSQDVGFWEGEVVRELSVEEQIKRNRYYDEDEDEE B97CE0D0B4B5E90B q6mg76_rat Apom Bat4 C2 C4a Cfb Csnk2b G7e Hspa1a Hspa1b Ly6g5c Ly6g6c Neu1 Ng35 Rps25-ps2 Skiv2l Hspa1l Stk19 protein protein rat Rattus norvegicus (Rat) Rat MMETERLVLPPPDPLNLPLRALEVGCTGRWELLNVPGPPESTLPHGLPPCAPDLCQEAEQLFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAALGTPVPSDLQAQRHPTTGHILGYKEVLLENTNLSATTSLSLRRPPGPASQSLWGNPTQYPFWPGGMDEPSITDLSTREEAEEEIDFEKDLLTVPPGFKKGVDFAPKAPVPGLLSLSRLLEPLDLSGGDEGEGEAAGGPRGDAASASPSSTPLIRASSLEDLVLKEASTVVSTLEPLKPPPQEQWAVPVDVTSPVGDFYRLIPQPAFQWAFEPDVFQKQAILHLEQHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPEHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVARPVPLEHYLFTGNSPKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLALLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLRRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALADLTKRLGALEEPDVTGQLADLPEYYSWAEELTETRNMIQRRIMESVNGLKSLSVGRVVVVKNEEHHNALGVILQVSSNSTSRVFTTLVLCDKPAVSENPRDKGPATPDVPHPDDLVGFKLFLPEGPCEHTVAKLQPGDVAAISTKVLRVNGEKISEDFSKRQQPKFRKDPPLAAVTTAVQELLRLAQAYPAGPPTLDPINDLQLKDVAVVEGGLRARKLEELIRGAQCVHSPRFPAQYVKLQERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSSHELLLTELMFDNALSALRPEEIAALLSGLVCQSPGDPGDQLPSTLKQGVERVKAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ CE286D4DF21EE2C4 runx2_rat Runt-related transcription factor 2 Runx2 Cbfa1 Osf2 Core-binding factor subunit alpha-1 Osteoblast-specific transcription factor 2 protein protein rat Rattus norvegicus (Rat) Rat MLHSPHKQPQNHKCGANFLQEDSKEALVFKWLISAGHYQPPRPTESVSALSTVHAVIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRI DIP protein Q9Z2J9 original sequence version: 91 D6465458B60628A2 gels_rat Gelsolin Gsn Actin-depolymerizing factor Brevin protein protein rat Rattus norvegicus (Rat) Rat MAPYCSSLRSALLVLALCALSPSHAATASRGRAQERAPQSRVSETRPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFQGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGSEPEAMLQVLGPKPDLPQGTEDTAKEDAANRRLAKLYKVSNSGGSMSVSLVADENPFAQSALRSEDCFILDHGRDGKIFVWKGKQANMDERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVLVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTTPASTRLFQVRASSSGATRAVEVMPKAGALNSNDAFVLKTPSAAYLWVGTGASDAEKTGALELLKVLRAQHVQVEEGSEPDGFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDDYWSVDPLDRALAELAA E9B6A20C5A80D0E8 q08775-3 Runt-related transcription factor 2 PEBP2-alpha A1 Runx2 Aml3 Cbfa1 Osf2 Pebp2a Acute myeloid leukemia 3 protein Core-binding factor subunit alpha-1 Oncogene AML-3 Osteoblast-specific transcription factor 2 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit protein protein mouse Mus musculus Mouse MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSSLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY EAF92506819B2D28 q568z8_rat Ddx17 protein protein rat Rattus norvegicus (Rat) Rat MSLPSLSLPHQPAQCLLIDVEDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSTSYRDRSETDRASYANGSGYGSPNSAFGAQAGQYTYAQGTYGAAAYGTSGYTAQEYAAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK 15D1E559D7B9D965 ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ DIP protein P17844 original sequence version: 98 DIP protein P17844 original sequence version: 148 DIP protein P17844 original sequence version: 137 DIP protein P17844 original sequence version: 124 DIP protein P17844 original sequence version: 177 DIP protein P17844-1 original sequence version: 177 DIP protein P17844 original sequence version: 179 DIP protein P17844 original sequence version: 182 84DF684FD6871594 runx2_mouse Runt-related transcription factor 2 Runx2 Aml3 Cbfa1 Osf2 Pebp2a Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 protein protein mouse Mus musculus Mouse MLHSPHKQPQNHKCGANFLQEDCKKALAFKWLISAGHYQPPRPTESVSALTTVHAGIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSSLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY DIP protein Q08775 original sequence version: 136 DIP protein Q08775 original sequence version: 135 E87A4497ED19EE0E q6ayi1_rat DEAD box protein 5 Ddx5 Probable ATP-dependent RNA helicase DDX5 rCG_35034 protein protein rat Rattus norvegicus (Rat) Rat MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVANMHNGMNQQAYAYPATAAAAPMIGYPMPTGYSQ 500EB551BA8F4F75 ddx17-ddx5 1 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 2B Also co-purified but could not be mapped to proteins: alpha-actinin and HSP70 ddx17-ddx5-1 2 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3A and B ddx5-runx2 5 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component gal4 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 3D ddx5-runx2-1 3 8 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization 3C ddx5-runx2-2 4 10 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey c-terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain gal4 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 36 39 physical association physical association 3E ddx5-runx2-3 4 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 3F