mpidb The Microbial Protein Interaction Database Contribution of the FtsQ transmembrane segment to localization to the cell division site. Contribution of the FtsQ transmembrane segment to localization to the cell division site. J. Bacteriol. (0021-9193) 2007 imex curation Scheffers D.J., Robichon C., Haan G.J., den Blaauwen T., Koningstein G., van Bloois E., Beckwith J., Luirink J. dirk-jan.scheffers@falw.vu.nl 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Scheffers D.J., Robichon C., Haan G.J., den Blaauwen T., Koningstein G., van Bloois E., Beckwith J., Luirink J. dirk-jan.scheffers@falw.vu.nl Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation Contribution of the FtsQ transmembrane segment to localization to the cell division site. Contribution of the FtsQ transmembrane segment to localization to the cell division site. J. Bacteriol. (0021-9193) 2007 imex curation Scheffers D.J., Robichon C., Haan G.J., den Blaauwen T., Koningstein G., van Bloois E., Beckwith J., Luirink J. dirk-jan.scheffers@falw.vu.nl 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Scheffers D.J., Robichon C., Haan G.J., den Blaauwen T., Koningstein G., van Bloois E., Beckwith J., Luirink J. dirk-jan.scheffers@falw.vu.nl Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation yidc_ecoli Membrane protein insertase YidC Foldase YidC Inner membrane protein YidC Membrane integrase YidC Oxa1Ec JW3683 b3705 yidC protein protein ecoli Escherichia coli (strain K12) MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGLHSREKKKS 95EBC5DAB4F2FCFB secy_ecoli Protein translocase subunit SecY secY prlA b3300 JW3262 protein protein ecoli Escherichia coli (strain K12) MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYGR DIP protein P0AGA2 original sequence version: 78 DIP protein P0AGA2 original sequence version: 60 DIP protein P0AGA2 original sequence version: 41 DIP protein P0AGA2 original sequence version: 56 DIP protein P0AGA2 original sequence version: 49 711CA63CD8809763 ftsq_ecoli Cell division protein FtsQ ftsQ b0093 JW0091 protein protein ecoli Escherichia coli (strain K12) MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ 839A3D34B948CEAB ftsb_ecoli Cell division protein FtsB ftsB b2748 JW2718 ygbQ protein protein ecoli Escherichia coli (strain K12) MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR 9B50A7EF637809D7 ftsl_ecoli Cell division protein FtsL ftsL mraR b0083 JW0081 yabD protein protein ecoli Escherichia coli (strain K12) MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQK 6DD5DF7B2ECB7090 ftsq-secy-1 2 4 unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) association association Fig. 3A ftsq-ftsb-5 1 5 unspecified role unspecified role bait bait P06136:p.[Leu29Pro;Leu32Pro;Val38Pro] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain V P Wed May 02 18:05:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu29pro,leu32pro,val38pro' Tue Jun 30 16:57:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu29Pro;Leu32Pro;Val38Pro]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig. 5