mpidb The Microbial Protein Interaction Database Complex formation by the mrpABCDEFG gene products, which constitute a principal Na+/H+ antiporter in Bacillus subtilis. Complex formation by the mrpABCDEFG gene products, which constitute a principal Na+/H+ antiporter in Bacillus subtilis. J. Bacteriol. (0021-9193) 2007 imex curation Kajiyama Y., Otagiri M., Sekiguchi J., Kosono S., Kudo T. no complex members ,some interactions probably indirect. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions baciu Bacillus subtilis pull down pull down western blot western blot Immuno blot Immuno blot Kajiyama Y., Otagiri M., Sekiguchi J., Kosono S., Kudo T. no complex members ,some interactions probably indirect. Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation Complex formation by the mrpABCDEFG gene products, which constitute a principal Na+/H+ antiporter in Bacillus subtilis. Complex formation by the mrpABCDEFG gene products, which constitute a principal Na+/H+ antiporter in Bacillus subtilis. J. Bacteriol. (0021-9193) 2007 imex curation Kajiyama Y., Otagiri M., Sekiguchi J., Kosono S., Kudo T. no complex members ,some interactions probably indirect. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions baciu Bacillus subtilis bn-page blue native page bn-page anti tag western anti tag western blot anti tag western Kajiyama Y., Otagiri M., Sekiguchi J., Kosono S., Kudo T. no complex members ,some interactions probably indirect. First-dimension BN-PAGE gel and then the second-dimension Tricine SDS-PAGE gel to separate complex members. Accepted 2013-JAN-03 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation mrpb_bacsu Na(+)/H(+) antiporter subunit B Mrp complex subunit B Multiple resistance and pH homeostasis protein B yufU BSU31610 mrpB protein protein bacsu Bacillus subtilis MNEQKTNDLILQTATKLVSFIILLFSFYLFLSGHNAPGGGFVGGLITSSSIVLLLLAYDLKTVRSLLPVNFIYVAGAGLLLAVLTGVGSFVFGAPFLTHTFGYFQLPILGKTELATATIFDLGVYLVVVGITMTIIQTIGEEE 7170B6B649784F85 mrpf_bacsu Na(+)/H(+) antiporter subunit F Mrp complex subunit F Multiple resistance and pH homeostasis protein F Sodium-cholate efflux protein MrpF yufC BSU31650 mrpF protein protein bacsu Bacillus subtilis MFTLILQIALGIMAVSTFLYVIRVIKGPTVPDRVVALDAIGINLIAITALVSILLKTSAFLDIILLLGILSFIGTIAFSKFLEKGEIIENDRNR 0798D6ED6FB51DAB mrpg_bacsu Na(+)/H(+) antiporter subunit G Mrp complex subunit G Multiple resistance and pH homeostasis protein G yufB BSU31660 mrpG protein protein bacsu Bacillus subtilis MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLWFVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKEDSYL 720217AC8286BAFC mrpa_bacsu Na(+)/H(+) antiporter subunit A Mrp complex subunit A Multiple resistance and pH homeostasis protein A ntrA shaA yufT BSU31600 mrpA protein protein bacsu Bacillus subtilis MQLLHLAILSPFLFAFIIPFLAKYAKRVHTGWFVLILPVLLFIYFLPMIRMTQSGETLRSVLEWIPSLGINFTVYIDGLGLLFALLITGIGSLVTLYSIFYLSKEKEQLGPFYVYLLMFMGAMLGVVLVDNVMVLYMFWELTSLSSFLLIGYWYKREKSRYGAAKSLLITVSGGLCMLGGFILLYLITDSFSIREMVHQVQLIAGHELFIPAMILILLGAFTKSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGIYVIARFSPIFAFSAQWFWIVSLVGLFTMVWGSFHAVKQTDLKSILAFSTVSQLGMIISMLGVSAAALHYGHTEYYTVAAMAAIFHLINHATFKGSLFMAVGIIDHETGTRDIRKLGGLMAIMPITFTISLIGTFSMAGLPPFNGFLSKEMFFTSMLRVTHFDLFNVQTWGVLFPLFAWIGSVFTFIYSMKLLFKTFRGNYQPEQLEKQAHEAPVGMLVPPVILVALAVSLFFFPNILSYSLIEPAMNSIYPTLLDGHEKFHVHISQWHGVTTELLMTAGIVVIGTIGYLSLNKWKGIYKLFPSKLTLNRLYDKLLTMMEKGSYRVTKQYMTGFLRDYLLYIFAGFIILIGGAFAIKGGFSFKTEGMAKIGVYEIILTLVMISATVATVFARSRLTAIIALGVVGYTLALFFVIFRAPDLALTQLVIETISVALFLLCFYHLPKLRLKTKTRTFRMTNFIISLGVGVIVTLLGIASSSQRTKDSIASFFVKHSHDLGGGDNVVNVILVDFRGFDTMFEITVLTIAALGIYSMIKTKVKEEGKSGE C6DE22B56DAA725D mrpe_bacsu Na(+)/H(+) antiporter subunit E Mrp complex subunit E Multiple resistance and pH homeostasis protein E BSU31640 mrpE protein protein bacsu Bacillus subtilis MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKLCFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMDISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR 9CDA81C3156BDE7F mrpc_bacsu Na(+)/H(+) antiporter subunit C Mrp complex subunit C Multiple resistance and pH homeostasis protein C yufV BSU31620 mrpC protein protein bacsu Bacillus subtilis MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEHAKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE 26E41EFAB6AC9CA0 mrpd_bacsu Na(+)/H(+) antiporter subunit D Mrp complex subunit D Multiple resistance and pH homeostasis protein D yufD BSU31630 mrpD protein protein bacsu Bacillus subtilis MNNFVILPILIPLLSAILLIFMTKNLMLMRIFSTAASAIGIVISGILVQTVFTKGIQTLSLGGWKAPYGIVLAADQFASLLVLTTAIIGLLVGLYSFRSVGEKRERSFYYSGVQFLLAGVSGAFLTGDLFNMYVFFELLLIASYMLIVLGGTKIQLRESLKYIVFNIVSSALFVIGVGFLYAVTGTLNMADLSVKISESGQTGLITVIGVLLLLVFGMKGGIFPLYFWLPGSYYAPPAAISALFGALLTKVGLYAITRVFTLIFIHDTAFTHQLMIWLAALTVIFGVIGSLAYSNVMKIVIYNIITAVGVILFGVAVHTPASIQGAIYYLIHDMLIKGALFMLAGTLIALTGTASLHKMGGLIKRYPVLGWMFFISAISLAGIPPLSGFVGKFKIAEGGFAEGEFTISMLILLSSLLVLYSVLRIFIHAFWGEEKETPKPNHRTAKGLLYPAAIFLLLSLLFGLGTEWVSPYVDQAAETLLNPEKYIEAVLKE 8A29662C5DF64BFB mrpa-mrpe 1 6 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Fig. 2 mrpb-mrpe 1 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2 mrpc-mrpe 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2 mrpd-mrpe 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2 mrpe-mrpe 1 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association mrpf-mrpe 1 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2 mrpa-mrpb 2 7 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3 mrpg-mrpe 1 5 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association