mpidb The Microbial Protein Interaction Database Interactions between the lipoprotein PilP and the secretin PilQ in Neisseria meningitidis. Interactions between the lipoprotein PilP and the secretin PilQ in Neisseria meningitidis. J. Bacteriol. (0021-9193) 2007 imex curation Balasingham SV, Collins RF, Assalkhou R, Homberset H, Frye SA, Derrick JP, Tønjum T 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Balasingham SV, Collins RF, Assalkhou R, Homberset H, Frye SA, Derrick JP, Tønjum T Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation Interactions between the lipoprotein PilP and the secretin PilQ in Neisseria meningitidis. Interactions between the lipoprotein PilP and the secretin PilQ in Neisseria meningitidis. J. Bacteriol. (0021-9193) 2007 imex curation Balasingham SV, Collins RF, Assalkhou R, Homberset H, Frye SA, Derrick JP, Tønjum T 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy tag visualisation tag visualisation Balasingham SV, Collins RF, Assalkhou R, Homberset H, Frye SA, Derrick JP, Tønjum T Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation q7dd77_neimb pilP NMB1811 protein protein strain mc58 Neisseria meningitidis serogroup B MKHYALLISFLALSACSQGSEDLNEWMAQTRREAKAEIIPFQAPTLPVAPVYSPPQLTGPNAFDFRRMETDKKGENAPDTKRIKETLEKFSLENMRYVGILKSGQKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIVLNELIEDSTGNWVSRKAELLLNSSDKNTEQAAAPAAEQN F08ED4DBF0E4E27F pilq_neimb Type IV pilus biogenesis and competence protein PilQ pilQ NMB1812 protein protein strain mc58 Neisseria meningitidis serogroup B MNTKLTKIISGLFVATAAFQTASAGNITDIKVSSLPNKQKIVKVSFDKEIVNPTGFVTSSPARIALDFEQTGISMDQQVLEYADPLLSKISAAQNSSRARLVLNLNKPGQYNTEVRGNKVWIFINESDDTVSAPARPAVKAAPAAPAKQQAAAPSTKSAVSVSEPFTPAKQQAAAPFTESVVSVSAPFSPAKQQAAASAKQQAAAPAKQQAAAPAKQQAAAPAKQTNIDFRKDGKNAGIIELAALGFAGQPDISQQHDHIIVTLKNHTLPTTLQRSLDVADFKTPVQKVTLKRLNNDTQLIITTAGNWELVNKSAAPGYFTFQVLPKKQNLESGGVNNAPKTFTGRKISLDFQDVEIRTILQILAKESGMNIVASDSVNGKMTLSLKDVPWDQALDLVMQARNLDMRQQGNIVNIAPRDELLAKDKALLQAEKDIADLGALYSQNFQLKYKNVEEFRSILRLDNADTTGNRNTLISGRGSVLIDPATNTLIVTDTRSVIEKFRKLIDELDVPAQQVMIEARIVEAADGFSRDLGVKFGATGKKKLKNDTSAFGWGVNSGFGGDDKWGAETKINLPITAAANSISLVRAISSGALNLELSASESLSKTKTLANPRVLTQNRKEAKIESGYEIPFTVTSIANGGSSTNTELKKAVLGLTVTPNITPDGQIIMTVKINKDSPAQCASGNQTILCISTKNLNTQAMVENGGTLIVGGIYEEDNGNTLTKVPLLGDIPVIGNLFKTRGKKTDRRELLIFITPRIMGTAGNSLRY 1CC24EF102DC4BC9 pilp-pilq-1 1 4 unspecified role unspecified role prey prey region Q70M91-217-478 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Q7DD77-81-102 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain cys-16 Q7DD77-1-16 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 7 and table 3 pilp-pilq-3 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 8