mpidb The Microbial Protein Interaction Database Functional comparison of the two Bacillus anthracis glutamate racemases. Functional comparison of the two Bacillus anthracis glutamate racemases. 2010 2007 imex curation Dodd D Reese JG, Louer CR, Ballard JD, Spies MA, Blanke SR 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dodd D Reese JG, Louer CR, Ballard JD, Spies MA, Blanke SR Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation a0a6l8pkk6_bacan Glutamate racemase racE2 murI GBAA_4717 protein protein bacan Bacillus anthracis MKLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGIIGTIGTVKSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTTGKIGLFKEIASKWFGQPIENVKHIHLEKE 6B32774D01BB56ED race2-race2 1 2 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association figure 2c