mpidb The Microbial Protein Interaction Database Structural properties of periplasmic SodCI that correlate with virulence in Salmonella enterica serovar Typhimurium. Structural properties of periplasmic SodCI that correlate with virulence in Salmonella enterica serovar Typhimurium. J. Bacteriol. (0021-9193) 2007 imex curation Krishnakumar R., Kim B., Mollo E.A., Imlay J.A., Slauch J.M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions salty Salmonella typhimurium molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krishnakumar R., Kim B., Mollo E.A., Imlay J.A., Slauch J.M. Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation Structural properties of periplasmic SodCI that correlate with virulence in Salmonella enterica serovar Typhimurium. Structural properties of periplasmic SodCI that correlate with virulence in Salmonella enterica serovar Typhimurium. J. Bacteriol. (0021-9193) 2007 imex curation Krishnakumar R., Kim B., Mollo E.A., Imlay J.A., Slauch J.M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint predetermined predetermined participant predetermined Krishnakumar R., Kim B., Mollo E.A., Imlay J.A., Slauch J.M. Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation sodc1_salty Superoxide dismutase [Cu-Zn] 1 sodCI STM1044 sodC1 sodC protein protein salty Salmonella typhimurium MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNGLTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLVVNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK 1EC743EE2AB38CAE sodc1-sodc1 1 3 unspecified role unspecified role unspecified role unspecified role P0CW86:p.[Tyr107Glu;Tyr129Glu] P0CW86-87-109 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 19:30:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr107glu,tyr129glu' Tue Jun 30 19:51:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr107Glu;Tyr129Glu]' physical association physical association figure 1 sodc1-sodc1-1 2 3 unspecified role unspecified role unspecified role unspecified role P0CW86:p.[Tyr107Glu;Tyr129Glu] P0CW86-87-109 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 17:59:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr107glu,tyr129glu' Tue Jun 30 20:14:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr107Glu;Tyr129Glu]' salty Salmonella typhimurium direct interaction direct interaction figure 2 Purified SodCI dier is resistant to proteinase K. Monomeric SodC from E. coli was inactivated. Protease-sensitive sites that are buried in the dimer become exposed in monomeric SodCI.