UniProt UniProt http://www.uniprot.org Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Infect. Immun. (0019-9567) 2007 mimix curation Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wvu.edu 15-Nov-2012: Contacted by pporras. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wu.edu cstehlik@hsc.wvu.edu Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. Infect. Immun. (0019-9567) 2007 mimix curation Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Infect. Immun. (0019-9567) 2007 mimix curation Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wvu.edu 15-Nov-2012: Contacted by pporras. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wu.edu cstehlik@hsc.wvu.edu Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. Infect. Immun. (0019-9567) 2007 mimix curation Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Infect. Immun. (0019-9567) 2007 mimix curation Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wvu.edu 15-Nov-2012: Contacted by pporras. human-jurkat Homo sapiens jurkat Human T cell leukemia anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wu.edu cstehlik@hsc.wvu.edu Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. Infect. Immun. (0019-9567) 2007 mimix curation Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Infect. Immun. (0019-9567) 2007 mimix curation Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wvu.edu 15-Nov-2012: Contacted by pporras. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wu.edu cstehlik@hsc.wvu.edu Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. Infect. Immun. (0019-9567) 2007 mimix curation Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Infect. Immun. (0019-9567) 2007 mimix curation Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wvu.edu 15-Nov-2012: Contacted by pporras. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wu.edu cstehlik@hsc.wvu.edu Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. Infect. Immun. (0019-9567) 2007 mimix curation Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation. Infect. Immun. (0019-9567) 2007 mimix curation Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wvu.edu 15-Nov-2012: Contacted by pporras. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dorfleutner A., Bryan N.B., Talbott S.J., Funya K.N., Rellick S.L., Reed J.C., Shi X., Rojanasakul Y., Flynn D.C., Stehlik C. Origin of POP1/PYDC1 according pmid 12656673. cstehlik@hsc.wu.edu cstehlik@hsc.wvu.edu Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. Infect. Immun. (0019-9567) 2007 mimix curation pydc2_human Pyrin domain-containing protein 2 PYDC2 POP2 Pyrin-only protein 2 cellular POP2 protein protein human Homo sapiens Human MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPP E2EE7A27FB90E586 nlrp1_human NACHT, LRR and PYD domains-containing protein 1 NLRP1 CARD7 DEFCAP KIAA0926 NAC NALP1 Death effector filament-forming ced-4-like apoptosis protein Nucleotide-binding domain and caspase recruitment domain Caspase recruitment domain-containing protein 7 protein protein human Homo sapiens Human MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQEPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYFYRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLIEGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLPLSS DIP protein Q9C000 original sequence version: 87 DIP protein Q9C000 original sequence version: 114 DIP protein Q9C000 original sequence version: 131 438F0DCE45C2562D nalp2_human NACHT, LRR and PYD domains-containing protein 2 NLRP2 NALP2 NBS1 PAN1 PYPAF2 Nucleotide-binding site protein 1 PYRIN domain and NACHT domain-containing protein 1 PYRIN-containing APAF1-like protein 2 protein protein human Homo sapiens Human MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI DIP protein Q9NX02 original sequence version: 138 4DBB0F6E9C2BC8A7 nalp4_human NACHT, LRR and PYD domains-containing protein 4 NLRP4 NALP4 PAN2 PYPAF4 RNH2 Cancer/testis antigen 58 PAAD and NACHT-containing protein 2 PYRIN and NACHT-containing protein 2 PYRIN-containing APAF1-like protein 4 Ribonuclease inhibitor 2 protein protein human Homo sapiens Human MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLIKHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIHLYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRDRFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGLNEPDSDLCGDLMEKRPVQVLLSSLLRKKMLPEASLLIAIKPVCPKELRDQVTISEIYQPRGFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKDLALTCQSTTSVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDLRRNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCVQELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQIHQCLKSLGERGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLRKLCFSVQNVFKKEDEHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCNQLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKTDFDEETQALLTAEEERNPNLTITDDCDTITRVEI DIP protein Q96MN2 original sequence version: 121 C2DDA1239274B2D1 asc_human Apoptosis-associated speck-like protein containing a CARD PYD and CARD domain-containing protein Target of methylation-induced silencing 1 Caspase recruitment domain-containing protein 5 ASC CARD5 TMS1 PYCARD protein protein human Homo sapiens Human MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS DIP protein Q9ULZ3 original sequence version: 116 455987286586F46A nal12_human NACHT, LRR and PYD domains-containing protein 12 NLRP12 NALP12 PYPAF7 RNO Monarch-1 PYRIN-containing APAF1-like protein 7 Regulated by nitric oxide protein protein human Homo sapiens Human MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLEMAQLLITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQSTCLLEVSLVTPRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPMQVQQQLLDTGRGHARTVGHQASPIKIETLFEPDEERPEPPRTVVMQGAAGIGKSMLAHKVMLDWADGKLFQGRFDYLFYINCREMNQSATECSMQDLIFSCWPEPSAPLQELIRVPERLLFIIDGFDELKPSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKLHRLLEHPRHVEILGFSEAERKEYFYKYFHNAEQAGQVFNYVRDNEPLFTMCFVPLVCWVVCTCLQQQLEGGGLLRQTSRTTTAVYMLYLLSLMQPKPGAPRLQPPPNQRGLCSLAADGLWNQKILFEEQDLRKHGLDGEDVSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGEGGAGPDQDVTRLLTEYAFSERSFLALTSRFLFGLLNEETRSHLEKSLCWKVSPHIKMDLLQWIQSKAQSDGSTLQQGSLEFFSCLYEIQEEEFIQQALSHFQVIVVSNIASKMEHMVSSFCLKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANKNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALEDLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC 8C10AFE4907C131B pydc1_human Pyrin domain-containing protein 1 PYDC1 ASC2 ASCI POP1 PYC1 PAAD-only protein 1 Pyrin-only protein 1 cellular POP1 protein protein human Homo sapiens Human MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA 4CDF6D672DDDD98E pydc2-pycard 5 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey in vitro In vitro physical association physical association 3A pydc2-nlrp2-4 5 9 unspecified role unspecified role prey prey in vitro In vitro 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association 3A pydc1-pycard 6 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 3B pydc1-pydc2 6 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 3B pydc2-nlrp2 6 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3C pydc2-nlrp2-1 4 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 3D pydc2-nlrp2-2 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association 3E pydc2-pycard-1 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3F pydc2-nlrp2-3 2 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 3F pydc2-nlrp4 2 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 3F pydc2-nlrp12 2 7 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 3F pydc2-nlrp1-1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3F pycard-pydc2 1 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 4B nlrp2-pycard 1 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 4E pycard-pydc1 1 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 4G