UniProt UniProt http://www.uniprot.org Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. J. Biol. Chem. (0021-9258) 2006 mimix curation Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn 01-March-2013: Contacted by IntAct-Help. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn Accepted 2013-JAN-31 by PPORRAS 01-March-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2006 mimix curation Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. J. Biol. Chem. (0021-9258) 2006 mimix curation Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn 01-March-2013: Contacted by IntAct-Help. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn Accepted 2013-JAN-31 by PPORRAS 01-March-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2006 mimix curation Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. J. Biol. Chem. (0021-9258) 2006 mimix curation Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn 01-March-2013: Contacted by IntAct-Help. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn Accepted 2013-JAN-31 by PPORRAS 01-March-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2006 mimix curation ppil1_human Peptidyl-prolyl cis-trans isomerase-like 1 PPIL1 Rotamase PPIL1 CYPL1 CGI-124 UNQ2425/PRO4984 protein protein human Homo sapiens Human MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG 2872DC3336CD05E4 cyclosporin_a Cyclosporin A small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) snw1_human SNW domain-containing protein 1 Nuclear protein SkiP Ski-interacting protein Nuclear receptor coactivator NCoA-62 SKIIP SKIP SNW1 protein protein human Homo sapiens Human MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE DIP protein Q13573 original sequence version: 156 0CC75E0D0B2CF842 snw1-ppil1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 5 snw1-ppil1-1 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait direct interaction direct interaction supplement. fig. 5 cyclosporin-ppil1 3 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component direct interaction direct interaction supplement. 4 cyclosporin-ppil1-1 3 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction supplement. 4