mbinfo MBInfo http://www.mechanobio.info/ Essential role of CIB1 in regulating PAK1 activation and cell migration. Essential role of CIB1 in regulating PAK1 activation and cell migration. J. Cell Biol. (0021-9525) 2005 imex curation Leisner T.M., Liu M., Jaffer Z.M., Chernoff J., Parise L.V. Coimmunoprecipitation from fig 1B could not be curated since the specific rat PAK isoform identified by the PAK antibodies in REF cells could not be found. The interactions in Figs 1C, 1D, 2, 3, 4, 6, S1, S5) could not be curated since the source of the recombinant proteins and kinase assay substrates used in these experiments could not be traced. parise@med.unc.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-ref52 Rattus norvegicus embryonic fibroblast cells ref52 Rattus norvegicus embryonic fibroblast cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Leisner T.M., Liu M., Jaffer Z.M., Chernoff J., Parise L.V. Coimmunoprecipitation from fig 1B could not be curated since the specific rat PAK isoform identified by the PAK antibodies in REF cells could not be found. The interactions in Figs 1C, 1D, 2, 3, 4, 6, S1, S5) could not be curated since the source of the recombinant proteins and kinase assay substrates used in these experiments could not be traced. Coimmunoprecipitation from fig 1B could not be curated since the specific rat PAK isoform identified by the PAK antibodies in REF cells could not be found. The interactions in Figs 1C, 1D, 2, 3, 4, 6, S1, S5) could not be curated since the source of the recombinant proteins and kinase assay substrates used in these experiments could not be traced. parise@med.unc.edu Accepted 2014-MAR-04 by ORCHARD J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation Essential role of CIB1 in regulating PAK1 activation and cell migration. Essential role of CIB1 in regulating PAK1 activation and cell migration. J. Cell Biol. (0021-9525) 2005 imex curation Leisner T.M., Liu M., Jaffer Z.M., Chernoff J., Parise L.V. Coimmunoprecipitation from fig 1B could not be curated since the specific rat PAK isoform identified by the PAK antibodies in REF cells could not be found. The interactions in Figs 1C, 1D, 2, 3, 4, 6, S1, S5) could not be curated since the source of the recombinant proteins and kinase assay substrates used in these experiments could not be traced. parise@med.unc.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Leisner T.M., Liu M., Jaffer Z.M., Chernoff J., Parise L.V. Coimmunoprecipitation from fig 1B could not be curated since the specific rat PAK isoform identified by the PAK antibodies in REF cells could not be found. The interactions in Figs 1C, 1D, 2, 3, 4, 6, S1, S5) could not be curated since the source of the recombinant proteins and kinase assay substrates used in these experiments could not be traced. parise@med.unc.edu Accepted 2014-MAR-04 by ORCHARD J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation cib1_human Calcium and integrin-binding protein 1 Calmyrin DNA-PKcs-interacting protein Kinase-interacting protein SNK-interacting protein 2-28 CIB1 CIB KIP PRKDCIP Calcium- and integrin-binding protein protein protein human Homo sapiens Human MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL DIP protein Q99828 original sequence version: 104 9AA19A0DE7AA1E05 pak1_rat Serine/threonine-protein kinase PAK 1 p21-activated kinase 1 p68-PAK Alpha-PAK Protein kinase MUK2 Pak1 protein protein rat Rattus norvegicus (Rat) Rat MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein P35465 original sequence version: 113 DIP protein P35465 original sequence version: 125 93BE32D8222F5B7B cib1_rat Calcium and integrin-binding protein 1 Cib1 Cib Kip Prkdcip Calmyrin DNA-PKcs-interacting protein Kinase-interacting protein protein protein rat Rattus norvegicus (Rat) Rat MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL 3B00B0228879FCC7 pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B cib1-pak1-1 2 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig 1A. cib1-pak1-3 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 1B. PAK1 coimmunoprecipitated weakly with CIB1 in suspended REF52 cells. PAK1 coimmunoprecipitated strongly with CIB1 in REF52 cells that were adhered to a fibronectin substrate for 30 min, but the interaction became weaker with longer times of adhesion to the fibronectin substrate.