UniProt UniProt http://www.uniprot.org Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Biochem. J. (0264-6021) 2004 mimix curation Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu 15-Nov-2012: Contacted by pporras. rat-liver rattus norvegicus liver Rat liver liver far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2004 mimix curation Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Biochem. J. (0264-6021) 2004 mimix curation Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu 15-Nov-2012: Contacted by pporras. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2004 mimix curation Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Biochem. J. (0264-6021) 2004 mimix curation Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu 15-Nov-2012: Contacted by pporras. rat-kidney Rat kidney kidney kidney [Renal] far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2004 mimix curation Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Biochem. J. (0264-6021) 2004 mimix curation Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu 15-Nov-2012: Contacted by pporras. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2004 mimix curation Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. Biochem. J. (0264-6021) 2004 mimix curation Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu 15-Nov-2012: Contacted by pporras. rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2004 mimix curation g3p_rat Glyceraldehyde-3-phosphate dehydrogenase Gapdh 38 kDa BFA-dependent ADP-ribosylation substrate BARS-38 Gapd Peptidyl-cysteine S-nitrosylase GAPDH protein protein rat Rattus norvegicus (Rat) Rat MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE D9E5ED4F38544C77 chp1_rat Calcineurin B homologous protein 1 Chp1 Calcineurin B-like protein Calcium-binding protein CHP Calcium-binding protein p22 Chp EF-hand calcium-binding domain-containing protein p22 protein protein rat Rattus norvegicus (Rat) Rat MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH 7B803EF0ABED829E g3p_rabit Glyceraldehyde-3-phosphate dehydrogenase GAPDH GAPD Peptidyl-cysteine S-nitrosylase GAPDH protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MVKVGVNGFGRIGRLVTRAAFNSGKVDVVAINDPFIDLHYMVYMFQYDSTHGKFHGTVKAENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSATHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMVHMASKE 346DB9B59DF3C1DF chp1-gapdh-1 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1A and 1B gapdh-chp1 5 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3A chp1-gapdh-2 4 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction 6A gapdh-chp1-1 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey direct interaction direct interaction 6B, 6C, 7A and 7B chp1-gapdh-3 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1A and 1B