mbinfo MBInfo http://www.mechanobio.info/ Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Mol. Cell. Biol. (0270-7306) 2004 imex curation Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu Accepted 2012-AUG-16 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Mol. Cell. Biol. (0270-7306) 2004 imex curation Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu Accepted 2012-AUG-16 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Mol. Cell. Biol. (0270-7306) 2004 imex curation Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu Accepted 2012-AUG-16 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Mol. Cell. Biol. (0270-7306) 2004 imex curation Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu Accepted 2012-AUG-16 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Mol. Cell. Biol. (0270-7306) 2004 imex curation Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu Accepted 2012-AUG-16 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP. Mol. Cell. Biol. (0270-7306) 2004 imex curation Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martinez-Quiles N., Ho H.Y., Kirschner M.W., Ramesh N., Geha R.S. Interaction detection method: GST pull down. The source of cortactin specified by the author. The source of WASP (endogenous) inferred from the cells (Jurkat T cells) used. The source of N-WASP traced from references. raif.geha@childrens.harvard.edu Accepted 2012-AUG-16 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation wasp_human Wiskott-Aldrich syndrome protein WAS IMD2 protein protein human Homo sapiens Human MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD DIP protein P42768 original sequence version: 183 DIP protein P42768 original sequence version: 168 DIP protein P42768 original sequence version: 132 DIP protein P42768 original sequence version: 155 7228428672B7CB78 wasl_bovin Neural Wiskott-Aldrich syndrome protein WASL protein protein bovin Bos taurus (Bovine) Bovine MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQINNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGAPPPPPNRMYPPPLPALPSSAPSGPPPPPPPLSVSGSVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGSKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVTDAPESTPPAPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDDEDFEDDDEWED 54B83B48F1CDB3B8 src8_human Src substrate cortactin CTTN EMS1 Amplaxin Oncogene EMS1 protein protein human Homo sapiens Human MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q14247 original sequence version: 148 7799326C2B4383BB wasl_mouse Neural Wiskott-Aldrich syndrome protein Wasl protein protein mouse Mus musculus Mouse MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYGSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPPSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPAPSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFEDDDEWED DIP protein Q91YD9 original sequence version: 57 F5ABF44DF9A9F716 src8_mouse Src substrate cortactin Cttn Ems1 protein protein mouse Mus musculus Mouse MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q60598 original sequence version: 136 DIP protein Q60598 original sequence version: 78 DIP protein Q60598 original sequence version: 135 8F5CA026ACCD6D4F wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E cttn-was-8 4 11 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association Fig 1B. cttn-wasl-1 4 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 1C. cttn-wasl-3 2 8 unspecified role unspecified role prey prey wgp region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain The WGP region includes the WH1, GBD and Proline-rich domains. n-terminal region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q60598:p.Trp525Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W K Wed May 02 18:58:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp525lys' Tue Jun 30 17:55:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp525Lys' Q60598:p.[Ser405Asp;Ser418Asp] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D Wed May 02 17:36:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser405asp,ser418asp' Tue Jun 30 19:09:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser405Asp;Ser418Asp]' Q60598:p.[Tyr466Asp;Tyr482Asp] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y D certain certain sequence position certain certain certain sequence position certain Y D Wed May 02 16:33:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr466asp,tyr482asp' Tue Jun 30 17:51:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr466Asp;Tyr482Asp]' Q60598:p.[Ser405Asp;Pro416Asp;Tyr466Asp;Tyr482Asp] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain P D certain certain sequence position certain certain certain sequence position certain Y D certain certain sequence position certain certain certain sequence position certain Y D Fri Jul 22 11:14:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser405asp,ser418asp,tyr466asp,tyr482asp' Wed May 02 20:28:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser405asp,pro416asp,tyr466asp,tyr482asp' Tue Jun 30 19:48:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser405Asp;Pro416Asp;Tyr466Asp;Tyr482Asp]' ecoli Escherichia coli (strain K12) 26 30 physical association physical association Fig 1D, 3E, 5A, 5B. wasl-cttn 4 11 unspecified role unspecified role prey prey mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 8 unspecified role unspecified role bait bait proline-rich region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 1E. was-cttn 6 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig 1F (left, lane 1). cttn-was-10 6 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig 1F (left, lane 2). wasl-cttn-2 1 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 1F (middle). cttn-wasl-5 1 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 1F(Right). cttn-wasl-6 3 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 2A. Cortactin and N-WASP colocalized only in bradykinin-stimulated cells, not in unstimulated cells. cttn-was-9 5 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 2B.