IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene. Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1992 imex curation Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M., Aaronson S.A. Method details from Bottaro JBC 1990. Specific binding is defined as cpm that are displaced with X100 excess of unlabeled ligand. NIH 3T3/NEO (vector transfectant) cells were used as negative controls. bottarod@mail.nih.gov 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M., Aaronson S.A. Method details from Bottaro JBC 1990. Specific binding is defined as cpm that are displaced with X100 excess of unlabeled ligand. NIH 3T3/NEO (vector transfectant) cells were used as negative controls. This experiment refers to two isoforms of KGFR - however the "two loop" molecule, which is missing the first IgG loop( UniProt gives this loop as aas 25-125) cannot be unambiguously identified from UniProt. bottarod@mail.nih.gov Accepted 2012-NOV-08 by PPORRAS 15-Nov-2012: Contacted by pporras. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1992 Only protein-protein interactions imex curation Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene. Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1992 imex curation Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M., Aaronson S.A. Method details from Bottaro JBC 1990. Specific binding is defined as cpm that are displaced with X100 excess of unlabeled ligand. NIH 3T3/NEO (vector transfectant) cells were used as negative controls. bottarod@mail.nih.gov 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M., Aaronson S.A. Method details from Bottaro JBC 1990. Specific binding is defined as cpm that are displaced with X100 excess of unlabeled ligand. NIH 3T3/NEO (vector transfectant) cells were used as negative controls. bottarod@mail.nih.gov Accepted 2012-NOV-08 by PPORRAS 15-Nov-2012: Contacted by pporras. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1992 Only protein-protein interactions imex curation Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene. Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1992 imex curation Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M., Aaronson S.A. Method details from Bottaro JBC 1990. Specific binding is defined as cpm that are displaced with X100 excess of unlabeled ligand. NIH 3T3/NEO (vector transfectant) cells were used as negative controls. bottarod@mail.nih.gov 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H., Chan A.M., Aaronson S.A. No idea how participants were detected Method details from Bottaro JBC 1990. Specific binding is defined as cpm that are displaced with X100 excess of unlabeled ligand. NIH 3T3/NEO (vector transfectant) cells were used as negative controls. This experiment refers to two isoforms of KGFR - however the "two loop" molecule, which is missing the first IgG loop( UniProt gives this loop as aas 25-125) cannot be unambiguously identified from UniProt. bottarod@mail.nih.gov Accepted 2012-NOV-08 by PPORRAS 15-Nov-2012: Contacted by pporras. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1992 Only protein-protein interactions imex curation fgf1_bovin Fibroblast growth factor 1 FGF1 AFGF FGFA HBGF-1 Acidic eye-derived growth factor II Acidic fibroblast growth factor Endothelial cell growth factor Heparin-binding growth factor 1 Prostatropin protein protein bovin Bos taurus (Bovine) Bovine MAEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD F636641F189F9BFD fgf2_bovin Fibroblast growth factor 2 FGF2 Basic fibroblast growth factor Heparin-binding growth factor 2 protein protein bovin Bos taurus (Bovine) Bovine MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS BE6CE70FA6107129 fgf7_human Fibroblast growth factor 7 FGF7 KGF Heparin-binding growth factor 7 Keratinocyte growth factor protein protein human Homo sapiens Human MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT B19192474E6049E2 fgfr2_human Fibroblast growth factor receptor 2 FGFR2 BEK KSAM Keratinocyte growth factor receptor KGFR K-sam protein protein human Homo sapiens Human MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT 6CD5001C960ED82F p21802-3 Fibroblast growth factor receptor 2 BFR-1 FGFR2IIIb KGFR FGFR2 BEK KGFR KSAM K-sam Keratinocyte growth factor receptor protein protein human Homo sapiens Human MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT 288CF737673BA4AB fgf1-fgf2-4 2 6 competitor competitor competitor unspecified role unspecified role human-m426 Human M426 embryonic lung fibroblasts m426 M426 Human embryonic lung fibroblast cell line 4 competitor competitor competitor unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] 5 competitor competitor competitor unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] 6 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-m426 Human M426 embryonic lung fibroblasts m426 M426 Human embryonic lung fibroblast cell line 8 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells physical association physical association Table 1, Figure 2 b-FGF was a poor competitor fgf1-fgf2-5 2 4 competitor competitor competitor unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] 7 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 5 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-brain Bos taurus brain brain Brain [cerebrum] 5 competitor competitor competitor unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association Table 1, Figure 2 fgf2-fgfr2-5 2 7 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 4 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association Table 1, Figure 2 fgf2-fgfr2-6 2 8 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 4 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association Table 1, Figure 2 fgf1-fgf2-2 1 8 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 6 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-m426 Human M426 embryonic lung fibroblasts m426 M426 Human embryonic lung fibroblast cell line physical association physical association 3A The presence/absence of the first IgG loop had little effect on KGF binding. fgf1-fgf2-3 3 6 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-m426 Human M426 embryonic lung fibroblasts m426 M426 Human embryonic lung fibroblast cell line 8 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells physical association physical association 3B The presence/absence of the first IgG loop had little effect on KGF binding.