UniProt UniProt http://www.uniprot.org Interaction of Disabled-1 and the GTPase activating protein Dab2IP in mouse brain. Interaction of Disabled-1 and the GTPase activating protein Dab2IP in mouse brain. Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Homayouni R., Magdaleno S., Keshvara L., Rice D.S., Curran T. rhomayouni@utmem.edu 11-Oct-2012: Contacted by IntAct-Help. mouse embryonic day 14.5 head cDNA library Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Homayouni R., Magdaleno S., Keshvara L., Rice D.S., Curran T. rhomayouni@utmem.edu Accepted 2012-SEP-27 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. mouse embryonic day 14.5 head cDNA library Brain Res. Mol. Brain Res. (0169-328X) 2003 Only protein-protein interactions imex curation Interaction of Disabled-1 and the GTPase activating protein Dab2IP in mouse brain. Interaction of Disabled-1 and the GTPase activating protein Dab2IP in mouse brain. Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Homayouni R., Magdaleno S., Keshvara L., Rice D.S., Curran T. rhomayouni@utmem.edu 11-Oct-2012: Contacted by IntAct-Help. mouse embryonic day 14.5 head cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Homayouni R., Magdaleno S., Keshvara L., Rice D.S., Curran T. rhomayouni@utmem.edu Accepted 2012-SEP-27 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. mouse embryonic day 14.5 head cDNA library Brain Res. Mol. Brain Res. (0169-328X) 2003 Only protein-protein interactions imex curation Interaction of Disabled-1 and the GTPase activating protein Dab2IP in mouse brain. Interaction of Disabled-1 and the GTPase activating protein Dab2IP in mouse brain. Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Homayouni R., Magdaleno S., Keshvara L., Rice D.S., Curran T. rhomayouni@utmem.edu 11-Oct-2012: Contacted by IntAct-Help. mouse embryonic day 14.5 head cDNA library Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Homayouni R., Magdaleno S., Keshvara L., Rice D.S., Curran T. rhomayouni@utmem.edu Accepted 2012-SEP-27 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. mouse embryonic day 14.5 head cDNA library Brain Res. Mol. Brain Res. (0169-328X) 2003 Only protein-protein interactions imex curation dab2p_mouse Disabled homolog 2-interacting protein ASK-interacting protein 1 DOC-2/DAB-2 interactive protein Dab2ip Kiaa1743 protein protein mouse Mus musculus Mouse MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQSVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC E3AF3FDA71FF96C3 dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS DIP protein P97318 original sequence version: 94 08404220792B1DB4 dab1-dab2ip 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure dab1-dab2ip-1 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 2 dab1-dab2ip-2 1 4 unspecified role unspecified role prey prey cell lysate cell lysate mouse-brain Mus musculus brain brain Brain [cerebrum] 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3 A and B synthetic peptide corresponding to the NPxY region of APLP1 (CELQRHGYENPTYRFLEE)