MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction between chicken protein tyrosine phosphatase 1 (CPTP1)-like rat protein phosphatase 1 (PTP1) and p60(v-src) in v-src-transformed Rat-1 fibroblasts. Interaction between chicken protein tyrosine phosphatase 1 (CPTP1)-like rat protein phosphatase 1 (PTP1) and p60(v-src) in v-src-transformed Rat-1 fibroblasts. Exp. Mol. Med. (1226-3613) 2002 Jung EJ., Kim CW. Phosphatases Text_Mining partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Jung EJ., Kim CW. Phosphatases Text_Mining Text_Mining Exp. Mol. Med. (1226-3613) 2002 partial coverage rapid curation Interaction between chicken protein tyrosine phosphatase 1 (CPTP1)-like rat protein phosphatase 1 (PTP1) and p60(v-src) in v-src-transformed Rat-1 fibroblasts. Interaction between chicken protein tyrosine phosphatase 1 (CPTP1)-like rat protein phosphatase 1 (PTP1) and p60(v-src) in v-src-transformed Rat-1 fibroblasts. Exp. Mol. Med. (1226-3613) 2002 Jung EJ., Kim CW. Phosphatases Text_Mining partial coverage rapid curation rat-fibroblast Rattus norvegicus fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Jung EJ., Kim CW. Phosphatases Text_Mining Text_Mining Exp. Mol. Med. (1226-3613) 2002 partial coverage rapid curation ptprr_rat Receptor-type tyrosine-protein phosphatase R Ptprr Ptp Protein-tyrosine phosphatase PCPTP1 Tyrosine phosphatase CBPTP PC12-PTP1 protein protein rat Rattus norvegicus (Rat) Rat MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPMFIYDHSQDIKKSLDIAQEAYKHNYPAPSEVQISKRHQIVDSAFPRPAYDPSLNLLAASGQDLEIENLPIPAANVIVVTLQMDIDKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKSQIELFVSPGNRKPGEPQALQAEEVLRSLNVDVLRQSLPQFGSIDVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIIIVTCLMIIYRLKERLQLSFRQDKEKNQEIHLSPIALQQAQSEAKAAHSMVQPDQAPKVLNVVVDPQGQCTPEIRNTASTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAVSTPREKVAMEYLQSASRVLTSPQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDPLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVIGVNECDNYTIRNLVLKRGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVQ mint Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus homomint E929E5473B6A9DE9 src_rat Proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein rat Rattus norvegicus (Rat) Rat MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein Q9WUD9 original sequence version: 74 DIP protein Q9WUD9 original sequence version: 94 mint homomint 453D1E904EC660A3 ptprr-src 1 PTP1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Src 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified direct interaction direct interaction F3 homomint mint ptprr-src-1 2 PTP1 3 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Src 4 antibody detection identification by antibody antibody detection predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association F2 homomint mint