mbinfo MBInfo http://www.mechanobio.info/ Essential role of neural Wiskott-Aldrich syndrome protein in podosome formation and degradation of extracellular matrix in src-transformed fibroblasts. Essential role of neural Wiskott-Aldrich syndrome protein in podosome formation and degradation of extracellular matrix in src-transformed fibroblasts. Cancer Res. (0008-5472) 2002 imex curation Mizutani K., Miki H., He H., Maruta H., Takenawa T. 3Y1 rat fibroblasts were transformed with v-src. Interaction detection: GST pull down. The source of cortactin-SH3 traced from references and the source of N-WASP (endogenous) inferred from the cells used (3Y1). takenawa@ims.u-tokyo.ac.jp 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions rat-3y1 Rat embryonic fibroblast 3Y1 cells 3y1 rat embyronic fibroblast line 3y1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mizutani K., Miki H., He H., Maruta H., Takenawa T. 3Y1 rat fibroblasts were transformed with v-src. Interaction detection: GST pull down. The source of cortactin-SH3 traced from references and the source of N-WASP (endogenous) inferred from the cells used (3Y1). takenawa@ims.u-tokyo.ac.jp Accepted 2012-SEP-03 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2002 Only protein-protein interactions imex curation Essential role of neural Wiskott-Aldrich syndrome protein in podosome formation and degradation of extracellular matrix in src-transformed fibroblasts. Essential role of neural Wiskott-Aldrich syndrome protein in podosome formation and degradation of extracellular matrix in src-transformed fibroblasts. Cancer Res. (0008-5472) 2002 imex curation Mizutani K., Miki H., He H., Maruta H., Takenawa T. 3Y1 rat fibroblasts were transformed with v-src. Interaction detection: GST pull down. The source of cortactin-SH3 traced from references and the source of N-WASP (endogenous) inferred from the cells used (3Y1). takenawa@ims.u-tokyo.ac.jp 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mizutani K., Miki H., He H., Maruta H., Takenawa T. 3Y1 rat fibroblasts were transformed with v-src. Interaction detection: GST pull down. The source of cortactin-SH3 traced from references and the source of N-WASP (endogenous) inferred from the cells used (3Y1). takenawa@ims.u-tokyo.ac.jp Accepted 2012-SEP-03 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2002 Only protein-protein interactions imex curation wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E src8_rat Src substrate cortactin Cttn protein protein rat Rattus norvegicus (Rat) Rat MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARAKKQTPPASPSPQPAEDRPPSSPIYEDAAPLKAEPSYGSSEPEPEYSTEAAGLPEASNQQGLAYTSEPVYETTEVPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDVITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ 059CDB52681E2592 src8_human Src substrate cortactin CTTN EMS1 Amplaxin Oncogene EMS1 protein protein human Homo sapiens Human MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q14247 original sequence version: 148 7799326C2B4383BB cttn-wasl-10 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey rat-3y1 Rat embryonic fibroblast 3Y1 cells 3y1 rat embyronic fibroblast line 3y1 physical association physical association Fig 3A. wasl-cttn-3 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig 3C.