UniProt UniProt http://www.uniprot.org The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hocevar B.A., Smine A., Xu X.X., Howe P.H. The cell line is the human fibrosarcoma HT1080-derived parental cell line, BAHgpt, which contains the selectable marker Escherichia coli guanine phosphoribosyltransferase (gpt) linked to the TGFbeta-responsive promoter 3TP howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. musvi-mv1lu Mustela vison mink lung epithelial cells Neovison vison mv1lu Mv1Lu mink lung epithelial crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway. EMBO J. (0261-4189) 2001 mimix curation Hocevar B.A., Smine A., Xu X.X., Howe P.H. howep@ccf.org 11-Oct-2012: Contacted by IntAct-Help. human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hocevar B.A., Smine A., Xu X.X., Howe P.H. The cell line is the human fibrosarcoma HT1080-derived parental cell line, BAHgpt, which contains the selectable marker Escherichia coli guanine phosphoribosyltransferase (gpt) linked to the TGFbeta-responsive promoter 3TP howep@ccf.org Accepted 2012-SEP-28 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 2001 mimix curation smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS DIP protein Q15796 original sequence version: 174 DIP protein Q15796 original sequence version: 100 DIP protein Q15796-1 original sequence version: 141 95406DB5FC0AA4C9 tgfbr2_musvi_protein protein protein musvi Mustela vison similar to mouse Q62312 UniProt entry tgfbr1_musvi_protein protein protein musvi Mustela vison similar to mouse Q64729 UniProt entry tgfr1_human TGF-beta receptor type-1 TGFBR1 Transforming growth factor-beta receptor type I TGF-beta type I receptor Serine/threonine-protein kinase receptor R4 Activin receptor-like kinase 5 ALK5 SKR4 Activin A receptor type II-like protein kinase of 53kD protein protein human Homo sapiens Human MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM DIP protein P36897 original sequence version: 161 179F11404725DDCB smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein P84022 original sequence version: 57 DIP protein P84022 original sequence version: 112 DIP protein P84022-1 original sequence version: 146 DIP protein P84022-1 original sequence version: 111 46DF5E8B371321AC dab2_human Disabled homolog 2 DAB2 DOC2 Differentially-expressed protein 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein human Homo sapiens Human MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA 5B2F8B510A580A77 tgfr2_human TGF-beta receptor type-2 TGFBR2 Transforming growth factor-beta receptor type II TGF-beta type II receptor protein protein human Homo sapiens Human MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK DIP protein P37173 original sequence version: 163 C541DA751FFBDBEB dab2_musvi_protein protein protein musvi Mustela vison similar to mouse P98078 Uniprot entry smad2-dab2 5 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 5A smad3-dab2 5 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 5A smad2-dab2-1 1 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 6A smad3-dab2-1 1 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 6A smad2-dab2-2 7 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 7A and B smad3-dab2-2 7 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 7B smad2-dab2-3 6 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 7B dab2-tgfbr1 2 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 8A dab2-tgfbr1-1 3 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 8C dab2-tgfbr1-5 4 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association 8C