mbinfo MBInfo http://www.mechanobio.info/ Characterization of the interaction between zyxin and members of the Ena/vasodilator-stimulated phosphoprotein family of proteins. Characterization of the interaction between zyxin and members of the Ena/vasodilator-stimulated phosphoprotein family of proteins. J. Biol. Chem. (0021-9258) 2000 imex curation Drees B., Friederich E., Fradelizi J., Louvard D., Beckerle M.C., Golsteyn R.M. The source of zyxin specified by the author and the source of Mena (endogenous) inferred from the cell line used (HeLa). golsteyn@curie.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Drees B., Friederich E., Fradelizi J., Louvard D., Beckerle M.C., Golsteyn R.M. The source of zyxin specified by the author and the source of Mena (endogenous) inferred from the cell line used (HeLa). golsteyn@curie.fr Accepted 2012-APR-18 by ORCHARD J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation Characterization of the interaction between zyxin and members of the Ena/vasodilator-stimulated phosphoprotein family of proteins. Characterization of the interaction between zyxin and members of the Ena/vasodilator-stimulated phosphoprotein family of proteins. J. Biol. Chem. (0021-9258) 2000 imex curation Drees B., Friederich E., Fradelizi J., Louvard D., Beckerle M.C., Golsteyn R.M. The source of zyxin specified by the author and the source of Mena (endogenous) inferred from the cell line used (HeLa). golsteyn@curie.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Drees B., Friederich E., Fradelizi J., Louvard D., Beckerle M.C., Golsteyn R.M. Protein binding was assayed by SPOTs analysis, a modified blot overlay procedure. The source of zyxin specified by the author and the source of Mena (endogenous) inferred from the cell line used (HeLa). golsteyn@curie.fr Accepted 2012-APR-18 by ORCHARD 20-Jun-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation enah_human Protein enabled homolog ENAH MENA protein protein human Homo sapiens Human MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA BF3252F6FCD1988B zyx_human Zyxin Zyxin-2 ZYX protein protein human Homo sapiens Human MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT 2833B1EFA260B762 enah_mouse Protein enabled homolog Enah Mena Ndpp1 NPC-derived proline-rich protein 1 protein protein mouse Mus musculus Mouse MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAAQSKVTATQDSTNLRCIFCGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERMERERLERERLERERLERERLEQEQLERQRQEREHVERLERERLERLERERQERERERLEQLEREQVEWERERRMSNAAPSSDSSLSSAPLPEYSSCQPPSAPPPSYAKVISAPVSDATPDYAVVTALPPTSTPPTPPLRHAATRFATSLGSAFHPVLPHYATVPRPLNKNSRPSSPVNTPSSQPPAAKSCAWPTSNFSPLPPSPPIMISSPPGKATGPRPVLPVCVSSPVPQMPPSPTAPNGSLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSPSAGAPASAETPLNPELGDSSASEPGLQAASQPAESPTPQGLVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTSEDNRPLTGLAAAIAGAKLRKVSRVEDGSFPGGGNTGSVSLASSKADAGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPSSQPSANGVQTEGLDYDRLKQDILDEMRKELAKLKEELIDAIRQELSKSNTA 592BB975EE20F77F zyx-enah-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait Q15942:p.Phe71Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:01:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe71ala' Tue Jun 30 16:42:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe71Ala' Q15942:p.[Phe71Ala;Phe93Ala;Phe104Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:48:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe71ala,phe93ala,phe104ala' Tue Jun 30 19:21:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe71Ala;Phe93Ala;Phe104Ala]' Q15942:p.Phe93Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:52:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe93ala' Tue Jun 30 17:12:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe93Ala' Q15942:p.[Phe71Ala;Phe93Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:06:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe71ala,phe93ala' Tue Jun 30 18:08:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe71Ala;Phe93Ala]' n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 3B. enah-zyx-1 2 5 unspecified role unspecified role bait bait evh1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9bact Bacteria 4 unspecified role unspecified role prey prey proline-rich sequence sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q15942:p.Phe71Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:49:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe71ala' Tue Jun 30 17:26:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe71Ala' chemical synthesis Chemical synthesis (Chemical synthesis) 17 21 direct interaction direct interaction Fig 1. A library of 187 overlapping synthetic peptides spanning the complete sequence human zyxin was immobilized on the SPOTs membrane and probed by the bait.