IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction between the F plasmid TraA (F-pilin) and TraQ proteins. Interaction between the F plasmid TraA (F-pilin) and TraQ proteins. Mol. Microbiol. (0950-382X) 1999 imex curation Harris R.L., Sholl K.A., Conrad M.N., Dresser M.E., Silverman P.M. 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Harris R.L., Sholl K.A., Conrad M.N., Dresser M.E., Silverman P.M. Accepted 2012-JUL-18 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 1999 Only protein-protein interactions imex curation pil1_ecoli Pilin traA F-pilin ECOK12F074 protein protein ecoli Escherichia coli (strain K12) MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL C65EEA3C6E7EF2A2 traq_ecoli Protein TraQ traQ ECOK12F094 protein protein ecoli Escherichia coli (strain K12) MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSREEREALEARQQAMMEGQQEGGHVSH 21132F30801EE31A traa-traq 1 2 biological role biological role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 biological role biological role prey prey physical association physical association Table 1. Analysis of TraA±TraQ interactions by yeast two-hybrid assay traq-traa 1 3 biological role biological role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 2 biological role biological role prey prey domain iv region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 10 12 physical association physical association Table 1 and figure 6