MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structures of the Chromobacterium violaceumω-transaminase reveal major structural rearrangements upon binding of coenzyme PLP. Crystal structures of the Chromobacterium violaceumω-transaminase reveal major structural rearrangements upon binding of coenzyme PLP. FEBS J. (1742-464X) 2012 Humble MS., Cassimjee KE., Håkansson M., Kimbung YR., Walse B., Abedi V., Federsel HJ., Berglund P., Logan DT. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Humble MS., Cassimjee KE., Håkansson M., Kimbung YR., Walse B., Abedi V., Federsel HJ., Berglund P., Logan DT. FEBS J. (1742-464X) 2012 Crystal structures of the Chromobacterium violaceumω-transaminase reveal major structural rearrangements upon binding of coenzyme PLP. Crystal structures of the Chromobacterium violaceumω-transaminase reveal major structural rearrangements upon binding of coenzyme PLP. FEBS J. (1742-464X) 2012 Humble MS., Cassimjee KE., Håkansson M., Kimbung YR., Walse B., Abedi V., Federsel HJ., Berglund P., Logan DT. in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Humble MS., Cassimjee KE., Håkansson M., Kimbung YR., Walse B., Abedi V., Federsel HJ., Berglund P., Logan DT. FEBS J. (1742-464X) 2012 q7nwg4_chrvo CV_2025 protein protein chrvo Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) MQKQRTTSQWRELDAAHHLHPFTDTASLNQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEQPWWYKHGKDMTPDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKARGLA mint 5CD2CC1AF273D260 q7nwg4 1 ω-transaminase 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction mint The atomic coordinates and structure factors for the Chromobacterium violaceum ω-transaminase crystal structures can be found in the RCSB Protein Data Bank (http://www.rcsb.org) under the accession codes 4A6R for the apo1 form and 4A6T for the apo2 form. f1c f3a t2 q7nwg4-q7nwg4 1 ω-transaminase 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.2 ω-transaminase 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.2 direct interaction direct interaction mint The atomic coordinates and structure factors for the Chromobacterium violaceum ω-transaminase crystal structures can be found in the RCSB Protein Data Bank (http://www.rcsb.org) under the accession codes 4A6U for the holoenzyme and 4A72 for the mixed form. f2 f3b f3c f5 t2 q7nwg4-1 2 ω-transaminases 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction mint sf1 st2