IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. Proteins are cross-linked with formaldehyde and will be associated in a chromatin complex. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-38b9 Mouse 38B9 38b9 Murine 38B9 Pro-B Cells ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-38b9 Mouse 38B9 38b9 Murine 38B9 Pro-B Cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-38b9 Mouse 38B9 38b9 Murine 38B9 Pro-B Cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. Cell (0092-8674) 2011 imex curation Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. Re-ChiP experiment in which proteins are first precipitated by antibodies to one protein (prey) and then to a second (bait) young@wi.mit.edu Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation il2ra_mouse_gene Interleukin-2 receptor subunit alpha gene gene gene mouse Mus musculus Mouse nodal_mouse_gene Nodal gene gene gene mouse Mus musculus Mouse po5f1_human_gene Human POU domain, class 5, transcription factor 1 gene gene gene human Homo sapiens Human smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein Q8BUN5 original sequence version: 57 46DF5E8B371321AC po5f1_mouse_gene POU domain, class 5, transcription factor 1 gene gene mouse Mus musculus Mouse smad7_mouse_gene Mouse Smad7 gene gene gene mouse Mus musculus Mouse sox2_mouse_gene Sox2 gene gene gene mouse Mus musculus Mouse myod1_mouse Myoblast determination protein 1 Myod1 Myod protein protein mouse Mus musculus Mouse MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHMGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVERISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL DIP protein P10085 original sequence version: 90 DIP protein P10085 original sequence version: 88 AEC6572277A78D54 smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein P84022 original sequence version: 57 DIP protein P84022 original sequence version: 112 DIP protein P84022-1 original sequence version: 146 DIP protein P84022-1 original sequence version: 111 46DF5E8B371321AC vpre2_mouse_gene Immunoglobulin omega chain gene gene gene mouse Mus musculus Mouse mef2d_mouse_gene Myocyte-specific enhancer factor 2D gene gene gene mouse Mus musculus Mouse lfty1_human_gene Human left-right determination factor 1 gene gene gene human Homo sapiens Human sox2_mouse Transcription factor SOX-2 Sox2 Sox-2 protein protein mouse Mus musculus Mouse MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM DIP protein P48432 original sequence version: 95 DIP protein P48432 original sequence version: 108 C40DE49E524C49F1 jund_mouse_gene Mouse Jund gene gene gene mouse Mus musculus Mouse aa1r_mouse_gene Adenosine receptor A1 gene gene gene mouse Mus musculus Mouse pnmt_mouse_gene Phenylethanolamine N-methyltransferase gene gene gene mouse Mus musculus Mouse rag2_mouse_gene Rag2 gene gene gene mouse Mus musculus Mouse id3_mouse_gene DNA-binding protein inhibitor ID-3 gene gene gene mouse Mus musculus Mouse lfty1_mouse_gene Left-right determination factor 1 gene gene gene mouse Mus musculus Mouse ari3a_mouse_gene AT-rich interactive domain-containing protein 3A gene gene gene mouse Mus musculus Mouse tdgf1_mouse_gene Teratocarcinoma-derived growth factor gene gene gene mouse Mus musculus Mouse spi1_mouse Transcription factor PU.1 Spi1 Sfpi1 Sfpi-1 31 kDa-transforming protein SFFV proviral integration 1 protein protein protein mouse Mus musculus Mouse MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHNNEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCFPYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH 765E9CC2F374EB6E max_mouse_gene Max gene gene mouse Mus musculus Mouse nanog_mouse Homeobox protein NANOG Nanog Ecat4 Enk Homeobox transcription factor Nanog Early embryo specific expression NK-type homeobox protein ES cell-associated protein 4 protein protein mouse Mus musculus Mouse MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI DIP protein Q80Z64 original sequence version: 43 DIP protein Q80Z64 original sequence version: 64 DIP protein Q80Z64 original sequence version: 77 DIP protein Q80Z64 original sequence version: 78 4EF96408B767C79F tnr19_mouse_gene Tumor necrosis factor receptor superfamily member 19 gene gene mouse Mus musculus Mouse junb_mouse_gene Mouse JunB gene gene gene mouse Mus musculus Mouse desm_mouse_gene Desmin gene gene gene mouse Mus musculus Mouse id2_mouse_gene Mouse Id2 gene gene gene mouse Mus musculus Mouse myod1_mouse_gene Myoblast determination protein 1 gene gene gene mouse Mus musculus Mouse po5f1_human POU domain, class 5, transcription factor 1 Octamer-binding transcription factor 3 Octamer-binding protein 3 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 4 protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN DIP protein Q01860 original sequence version: 131 DIP protein Q01860 original sequence version: 150 DIP protein Q01860 original sequence version: 138 934C58DAEA0C535B pmepa_mouse_gene Transmembrane prostate androgen-induced protein gene gene gene mouse Mus musculus Mouse lfty2_mouse_gene Left-right determination factor 2 gene gene gene mouse Mus musculus Mouse ep300_mouse Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 Ep300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein mouse Mus musculus Mouse MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGPQPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGMPSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQIPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINSQNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMNMPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTNMPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTPTPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSLPAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTEVNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMGAMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH DIP protein B2RWS6 original sequence version: 53 DIP protein B2RWS6 original sequence version: 73 DIP protein B2RWS6 original sequence version: 79 0E9B2D9508237671 po5f1_mouse POU domain, class 5, transcription factor 1 Pou5f1 Oct-3 Oct-4 Otf-3 Otf3 Octamer-binding transcription factor 3 NF-A3 Octamer-binding protein 3 Octamer-binding protein 4 protein protein mouse Mus musculus Mouse MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPPAYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLEKVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPLPPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN DIP protein P20263 original sequence version: 87 DIP protein P20263 original sequence version: 121 DIP protein P20263 original sequence version: 118 DIP protein P20263 original sequence version: 137 DIP protein P20263 original sequence version: 107 757E41DF52286714 smad4_mouse Mothers against decapentaplegic homolog 4 Smad4 Dpc4 Madh4 Deletion target in pancreatic carcinoma 4 homolog SMAD family member 4 protein protein mouse Mus musculus Mouse MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein P97471 original sequence version: 79 DIP protein P97471 original sequence version: 150 4FBDF5DED4442F86 kcrm_mouse_gene Mouse Creatine kinase M-type gene gene gene mouse Mus musculus Mouse Creatine kinase M-type lfty1_mouse _enhancer_5-3 Murine Lefty1 enhancer (5-3 prime) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GGTGGGAGGGAGACTGCCCTTTGTCATGTAGAAGGAGCTT pou5f1-po5f1 9 16 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 unspecified role unspecified role bait bait association association Fig. 1B POU5F1/OCT4 binds to the same region of the pou5f1 gene as SMAD3. smad3-po5f1 9 16 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role bait bait association association Fig. 1B SMAD3 binds to the same region of the pou5f1 gene as POU5F1/OCT4. smad3-lfty1 9 25 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role bait bait association association Fig. 1B SMAD3 binds to the same region of the lefty1 gene as OCT4/POU5F1. pou5f1-lfty1-1 9 25 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 unspecified role unspecified role bait bait association association Fig. 1B POU5F1/OCT4 binds to the same region of the lefty1 gene as SMAD3. pou5f1-po5f1-1 8 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role bait bait association association Smad3, the Smad2/3 complex, Pou5f1/Oct4, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B pou5f1-lfty1-2 8 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role bait bait association association Smad3, the Smad2/3 complex, Pou5f1/Oct4, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B pou5f1-max 8 47 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene sox2-max 8 26 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene nanog-max 8 37 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene smad3-max 8 17 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene sox2-po5f1-1 8 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role bait bait association association Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B nanog-po5f1 8 37 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B smad3-po5f1-1 8 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B sox2-lfty1 8 32 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait association association Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B nanog-lfty1 8 37 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey association association Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B smad3-lfty1-1 8 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Smad3, the Smad2/3 complex, Pou5f1/Oct4, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B smad3-pou5f1 1 47 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 3A smad3-pou5f1-1 11 47 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig. 3B Interaction is dependent on TGF-β signaling. smad3-lfty1-2 13 17 unspecified role unspecified role bait bait 47 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-lfty2 13 45 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait 47 unspecified role unspecified role prey prey association association Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-nodal 13 17 unspecified role unspecified role bait bait 47 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad7-pou5f1 13 19 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait 47 unspecified role unspecified role prey prey association association Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-po5f1-2 13 47 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. lfty1-lfty1 12 17 unspecified role unspecified role neutral component neutral component mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells 47 unspecified role unspecified role neutral component neutral component mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells 50 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3D This interaction is dependent on TGF-β signaling. smad3-nodal-2 10 47 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-smad7-2 10 19 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role ancillary ancillary 17 unspecified role unspecified role bait bait association association Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-lfty1-4 10 47 unspecified role unspecified role ancillary ancillary 17 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-lfty2-2 10 45 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role ancillary ancillary 17 unspecified role unspecified role bait bait association association Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-pou5f1-2 10 18 unspecified role unspecified role ancillary ancillary region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 3F Smad3 does not bind in the absence of Pou5f1. pou5f1-sox2 8 20 unspecified role unspecified role prey prey 47 unspecified role unspecified role bait bait association association Fig. 4D smad3-sox2 8 20 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 4D smad3-aa1r 5 28 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 4D myod1-aa1r 5 28 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig. 4D smad3-vpre2 2 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 4D spi1-vpre2 2 35 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey association association Fig. 4D smad3-pou5f1-3 11 47 unspecified role unspecified role prey prey 48 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 4G smad3-myod1 7 17 unspecified role unspecified role bait bait 48 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey association association Fig. 4G smad3-myod1-2 4 35 unspecified role unspecified role prey prey 48 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 4G smad3-myod1-3 6 21 unspecified role unspecified role ancillary ancillary 42 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-pnmt 6 21 unspecified role unspecified role ancillary ancillary 17 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-id2 6 17 unspecified role unspecified role bait bait 21 unspecified role unspecified role ancillary ancillary 41 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-junb 6 39 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role ancillary ancillary 17 unspecified role unspecified role bait bait association association Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-desm 6 40 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role ancillary ancillary 17 unspecified role unspecified role bait bait association association Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-tnfrsf19 3 38 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding smad3-vpre2-2 3 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding. smad3-rag2 3 17 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding smad3-jund-1 3 27 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding. smad3-id3 8 17 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5B pou5f1-id3 8 31 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role bait bait association association Fig. 5B smad3-pmepa 8 44 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 5B pou5f1-pmepa 8 47 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5B smad3-ari3a 5 33 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 5B myod1-ari3a 5 33 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig. 5B smad3-pmepa-1 5 44 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 5B myod1-pmepa 5 44 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig. 5B smad3-id3-1 2 17 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5B spi1-id3 2 35 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5B smad3-ari3a-1 2 33 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 5B spi1-ari3a 2 35 unspecified role unspecified role bait bait 33 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5B ep300-lfty1 10 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 46 unspecified role unspecified role bait bait association association fig. 6C This interaction requires activation of the TGF-beta pathway. ep300-lfty2 10 45 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 46 unspecified role unspecified role bait bait association association fig. 6C This interaction requires activation of the TGF-beta pathway. ep300-smad7 10 19 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 46 unspecified role unspecified role bait bait association association fig. 6C This interaction requires activation of the TGF-beta pathway. ep300-po5f1 10 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 46 unspecified role unspecified role bait bait association association fig. 6C This interaction requires activation of the TGF-beta pathway. smad3-lfty2 8 45 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7D smad3-tdgf1 8 34 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Fig. 7D Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. pou5f1-tdgf1 8 47 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7D smad3-mef2d 8 24 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7E myod1-mef2d 8 24 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7E myod1-kcrm 8 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 49 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 7E smad3-kcrm 8 49 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7E myod1-mef2d-1 5 24 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig. 7E myod1-kcrm-1 5 21 unspecified role unspecified role bait bait 49 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7E smad3-il2ra-1 3 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Supp. Fig. 3D Smad3 occupancy increases with loss of PU.1 and Spib at Il2ra.