MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Small heat shock protein AgsA forms dynamic fibrils. Small heat shock protein AgsA forms dynamic fibrils. FEBS Lett. (0014-5793) 2011 imex curation Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation Small heat shock protein AgsA forms dynamic fibrils. Small heat shock protein AgsA forms dynamic fibrils. FEBS Lett. (0014-5793) 2011 imex curation Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation Small heat shock protein AgsA forms dynamic fibrils. Small heat shock protein AgsA forms dynamic fibrils. FEBS Lett. (0014-5793) 2011 imex curation Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation Small heat shock protein AgsA forms dynamic fibrils. Small heat shock protein AgsA forms dynamic fibrils. FEBS Lett. (0014-5793) 2011 imex curation Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation Small heat shock protein AgsA forms dynamic fibrils. Small heat shock protein AgsA forms dynamic fibrils. FEBS Lett. (0014-5793) 2011 imex curation Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shi X., Wang Z., Yan L., Ezemaduka AN., Fan G., Wang R., Fu X., Yin C., Chang Z. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation ins_bovin Insulin INS protein protein bovin Bos taurus (Bovine) Bovine MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN DIP protein P01317 original sequence version: 131 75307CF78E61C06A d1mc98_saltm G0076_05535 G0077_01090 G0080_01105 G0084_01035 G0086_01165 G0087_01165 G0088_00455 G0089_00825 G0090_07045 G0094_02035 G0100_01165 G0101_01540 G0102_02680 G0111_01090 G0113_10535 G0117_01160 G0123_01165 G0124_01105 G0148_01090 G0157_00580 G0038_18570 G0040_02970 G0042_06875 G0045_01165 G0047_01035 G0048_01165 G0051_01105 G0052_01090 G0059_02620 G0061_03095 G0062_01035 G0063_01165 G0067_01100 G0069_01105 G0070_01035 G0071_09970 G0072_11680 agsA G0074_00455 G0170_01090 DRM14_06310 A3104_24200 A3S30_01455 A3T81_02660 A3U32_01440 A3V03_02660 A3V89_07420 A3W57_02660 A3W75_12755 A3X15_01970 A3X55_16115 A4N07_02660 A4O05_00065 A4O41_08605 A4R48_00075 A6D61_02725 AAA76_01945 AAB27_00060 AAB79_05750 AAC35_02660 ADQ28_00060 AF497_18410 AGM99_04655 AHN93_16085 AKH62_15315 AL144_02430 AL168_04900 AL184_04815 AQ530_06730 AVA38_05140 AVC05_11370 AVL16_24450 AWT30_00780 AXX99_14635 B1265_04395 B1398_22390 B1642_00600 B1P38_02335 B2E31_04975 B4V59_06865 B4W90_24305 B6362_02255 B7Q27_04395 B8Y16_08090 B8Z46_24215 B9C90_00125 B9C96_02605 B9M14_00600 B9O84_02085 BBQ66_06615 BIC00_04920 BIC13_02240 BK110_04595 BKM50_02970 BMS46_03410 BMU56_13560 BZ203_03100 BZZ88_08385 C5W43_00075 CA117_15780 CB102_04880 CB119_21385 CB198_09065 CB380_06500 AU613_01395 CVR97_27720 CB535_17020 CB570_17000 CB646_09220 CBM67_02660 CBM76_02660 CBZ90_04445 CC339_08980 CC403_18195 CC453_09765 CC652_05905 CC971_11465 CCP17_04655 CDZ72_08975 CE70_03835 CED07_12390 CEQ70_10765 CFF58_00075 CFF59_00030 CIX60_03340 CPS79_19605 CQO33_07255 CSG22_07130 D4361_04760 D4387_11750 D4422_11425 D5823_11105 D5N86_09555 D5N95_19420 D5O82_12460 D5P17_05385 D5X47_02740 D5Y28_13500 D6422_00580 D6J79_08910 D8S24_08550 DLB93_08825 DLR28_02475 DMI89_00075 DMO92_08720 DN165_00135 DNB97_04425 DNM27_12040 DNZ37_07955 DO533_23455 DP680_08805 DPB42_04880 DPD91_00625 DPF41_03090 DPF68_20345 DPS76_10580 DQD22_00135 DQR44_02745 DRR75_13715 DRT38_08145 DRT61_18820 DRV05_10655 DSF94_10675 DSG41_13665 DTF68_11400 DU071_03350 DU223_18265 DU657_19755 DU879_11230 DUV75_19315 DY580_11765 DYM27_25575 E0935_07470 E1A11_02720 E6W45_04540 EBD14_04630 EBK21_02735 EC404_08990 EEQ30_18940 EER35_07540 EHB09_13700 EL822_09015 ELS01_02720 EPB30_02735 EQG93_13145 EVY71_10550 EW905_04285 F0D96_08950 F2P00_01035 F3Q97_05420 F3R12_02655 F9G02_08995 F9O44_20730 FE758_12270 FEM52_00125 FGZ46_09045 FJM64_17845 FQX78_08180 GCZ80_00595 GEZ01_07985 KP44_04655 NG06_12585 R035_01945 Z700_02660 ZV33_02655 ZX03_05650 ZY40_14315 G0K44_02260 G0K46_01085 G0K47_06045 G0K48_05975 G0K49_06760 G0K52_10230 G0K53_10390 G0K56_09880 G0K58_08000 G0K59_08600 G0K61_06610 G0K65_02735 G0K68_12635 G0K70_00630 G0K72_02035 G0K74_04885 G0K75_02745 G0K78_01085 G0K80_06050 G0K83_12890 G0K84_03030 G0K85_06280 G0L03_11700 G0L06_10045 G0L07_19880 G0L10_13580 G0L14_12990 G0L15_24000 G0L18_24075 G0L19_24200 G0L20_20045 G0L24_05275 G0L25_06945 G0L29_20140 G0L31_14540 G0L32_13495 G0L34_19725 G0L35_19010 G0L36_02840 G0L37_02955 G0L38_22250 G0L40_19965 G0L42_10800 G0L48_10125 G0L49_21655 G0L51_06510 G0L52_22010 G0L55_02355 G0L59_21735 G0L62_06740 G0L63_06345 G0L65_05265 G0L67_20200 G0L68_00455 G0L70_21825 G0L73_03560 G0L76_20965 G0L77_10590 G0L78_00455 G0L79_02360 G0L83_17435 G0L88_14890 G0L89_21300 G0L91_07810 G0L93_08015 G0L96_02360 G0L98_07195 G0M00_08150 G0M02_07485 G0M05_20335 G0M10_08300 G0M14_21545 G0M16_21500 G0M21_07700 G0M26_06140 G0M30_11940 G0M33_02110 G0M35_02355 G0M36_08745 G0M38_20785 G0M39_08250 G0M41_08965 G0M45_08720 G0M53_09140 G0M55_02325 G0M56_05040 G0M58_05045 G0M63_18865 G0M65_00125 G0M67_02325 G0N45_00455 G0N48_02665 G0N51_22560 G0N53_02665 G0N55_00455 G0N57_06110 G0N58_00130 G0N59_01040 G0N60_00550 G0N61_01035 G0N62_06275 G0N64_16035 G0N65_02665 G0N66_00530 G0N67_02665 G0N71_00070 G0N75_01035 G0N78_05450 G0N82_08620 G0N84_01035 G0N85_02660 G0N86_00455 G0N88_03700 G0N89_01100 G0N90_02660 G0N92_08065 G0N94_01440 G0N95_02660 G0N98_01030 G0N99_17065 G0O00_02970 G0O03_19415 G0O10_00600 G0O14_15395 G0O15_10500 G0O18_00105 G0O19_01540 G0O20_02670 G0O22_02660 G0O25_05385 G0O27_00455 G0O31_00455 G0O32_07990 G0O36_15565 G0O37_12235 G0O39_01035 G0O40_01035 G0O41_02920 G0O42_02975 G0O43_01105 G0O44_19255 G0O47_00455 G0O52_00455 G0O55_00170 G0O57_02965 G0O58_01105 G0O59_10030 G0O60_00455 G0O63_00455 G0O66_10330 G0O68_00600 G0O70_01105 G0O71_01035 G0O74_06835 G0O75_01105 G0O77_01030 G0O78_00455 G0O80_00455 G0O81_02045 G0O82_01105 G0O84_01105 G0O85_01165 G0O86_15105 G0O87_06065 G0O88_10515 G0O89_01475 G0O92_01105 G0O93_02365 G0O94_10200 G0O97_11465 G0O99_04485 G0P00_08875 G0P01_02050 G0P02_02970 G0P05_10635 G0P06_01105 G0P08_02970 G0P12_07065 G0P13_01105 G0P17_00455 G0P18_15000 G0P19_02170 G0P24_00060 G0P26_01035 G0P28_01105 G0P30_01035 G0P31_01105 G0P36_17900 G0P37_14670 G0P41_02570 G0P44_02180 G0P45_05640 G0P48_01105 G0P49_20980 G0P52_01105 G0P53_03470 G0P56_00455 G0P57_01105 G0P58_00455 G0P63_20180 G0P65_00340 G0P67_12790 G0P68_04455 G0P69_05755 G0P73_00060 G0P75_10700 G0P76_12800 G1N61_02715 G1N64_02710 G1N66_02700 G1N68_02700 G1N71_02715 G1N72_02710 G1N86_02715 G1N87_02715 G1N91_05625 G1O00_13685 G1O02_02715 G1O04_02715 G1O05_02710 G1O08_02700 G1O10_02130 G1O12_02715 G1O16_02715 G1O17_02715 G1O18_02710 G1O23_02715 G1O25_02700 G1O26_02715 G1O27_02700 G1O28_02715 G1O29_02715 G1O32_02700 G1O34_02715 G1O38_02700 G1O40_02715 G1O43_02700 G1O46_12195 G1O48_02715 G1O49_02715 G1O51_02715 G1O53_02715 G1O62_02715 G1O63_02700 G1O65_02715 G1O67_02715 G1O68_02715 G1O69_02715 G1O71_02715 G1O72_02715 G1O76_02715 G1O77_02715 G1O80_02715 G1O81_02715 G1O83_02715 G1O84_02715 G1O87_02715 G1O88_02715 G1O89_02715 G1O90_02715 G1O93_02710 G1O94_02700 G1O96_02715 G1P02_02700 G1P03_00130 G1P06_02700 G1P09_02700 G1P10_02715 G1P12_02715 G1P14_03570 G1P15_22365 G1P17_02715 G1P19_02715 G1P23_02715 G1P24_02715 G1P25_02715 G1P26_02715 G1P29_00130 G1P31_02700 G1P35_02715 G1P36_02715 G1P37_00130 G1P40_12565 G1P44_02710 G1P45_02715 G1P47_02715 G1P48_02715 G1P51_02715 G1P52_00130 G1P53_00130 G1P54_02715 G1P55_02715 G1P56_02700 G1P57_02715 G1P58_02700 G1P59_02715 G1P61_02130 G1P64_02715 G1P67_02715 G1P69_02700 G1P72_02710 G1P75_02715 G1P76_02700 G1P78_02720 G1P83_02735 G1P84_02715 G1P87_02705 G1P90_02715 G1P91_02705 G1Q03_02715 G1Q08_14465 G1Q67_02710 G1Q78_02700 G1Q81_02715 G1Q83_02715 G1Q84_02700 G1Q85_02700 G1Q86_02700 G1Q88_07260 G1Q90_02700 G1Q91_02715 G1Q93_03965 G1Q96_02700 G1Q98_02715 G1Q99_02700 G1R01_02715 G1R02_13680 G1R03_02715 G1R04_02715 G1R08_02715 G1R13_02270 G1R15_11235 G1R20_09880 G1R21_02395 G1R22_14125 G1R23_02700 G1R27_02715 G1R28_02715 G1R29_02715 G1R30_02715 G1R31_02715 G1R36_02715 G1R38_02715 G1R40_13280 G1R42_09085 G1R44_02715 G1R45_02700 G1R47_02715 G1R48_14375 G1R51_02700 G1R53_02700 G1R63_02715 G1R69_05105 G1R87_02700 G1R93_02700 G1S02_02715 G2203_01090 G2212_02470 G2218_01670 G2221_20015 G2279_06420 G2290_15990 G2793_09995 G2918_09205 G2951_02660 G3221_000664 G3230_000012 G3231_000224 G3247_003006 G3248_000420 G3254_004437 G3263_002238 G3270_002995 G3275_000534 G3312_003463 G3336_003266 G3357_001466 G3369_000303 G3433_003117 G3460_000715 G3464_001937 G3593_000613 G3A35_02925 G3V06_000474 G3V14_000623 G3V17_000924 G3V21_004570 G3V56_001037 G3V57_000439 G3X03_000476 G4189_000437 G4190_000092 G4192_001928 G4198_000092 G4201_002369 G4202_001279 G4A01_002190 G4A73_000597 G4A83_002480 G4A85_000597 G4A87_000535 G4B68_001288 G4B72_000956 G4C74_000535 G4D32_002073 G4D46_000532 G4G47_002046 G4G62_001808 G4G67_000503 G4G68_004223 G4G75_000538 G4G76_000367 G4G79_002210 G4G97_001857 G4H00_000597 G4H04_003300 G4H07_000943 G4H08_004230 G4H18_000535 G4H21_000535 G4H24_000534 G4H63_004656 G4I66_004502 G4J07_004440 G4J08_003690 G4J11_002411 G4J12_002037 G4J18_003003 G4J20_001814 G4J37_000398 G4J39_000980 G4J41_001713 G4J45_000323 G4J90_004905 G4K02_000474 G4K03_003494 G4O54_000437 G4O56_002049 G4O59_001527 G4O60_000474 G4O67_000275 G4O69_000744 G4P29_003901 G4P83_000597 G4P85_000597 G4P89_001768 G4P91_000508 G4P93_000597 G4Q12_000295 G4Q28_000534 G4Q31_000532 G4Q50_000015 G4Q52_000015 G4Q59_000597 G4Q60_000597 G4Q63_002045 G4Q67_001853 G4Q94_004192 G4R01_000597 G4R02_000597 G4R15_000646 G4R16_000534 G4W68_000889 G4W73_000632 G4W86_000535 G4W87_000534 G4W88_000534 G4W91_001286 G4Y10_000525 G9269_000012 G9302_000597 G9304_003265 G9305_004310 G9309_001952 G9313_000597 G9314_003414 G9367_000535 G9381_000537 G9C24_001925 G9C41_000474 G9C46_000092 G9C47_000474 G9C49_000532 G9C57_000532 G9C64_001252 G9G03_001546 G9G04_000015 G9G34_004536 G9G36_000111 G9G45_003979 G9G50_004414 G9G62_002613 G9W19_001441 G9W28_001476 G9W45_001876 G9W52_003539 G9W63_003485 G9W65_000532 G9W79_000534 G9W95_000535 G9W96_001471 G9X40_004093 GB021_01035 GB040_20365 GB055_11115 GB076_01835 GB106_02660 GB114_10710 GB120_01030 GB122_09680 GB131_02475 GB139_02665 GB171_02660 GB209_10410 GB221_06470 GB224_14475 GB238_06055 GB280_01105 GB321_01105 GB331_02665 GB339_01585 GB342_02840 GB368_09680 GB372_09380 GB416_14080 GB452_13830 GB459_10965 GB466_09735 GB505_07565 GB510_19115 GB551_16590 GB567_10420 GB645_06180 GBS44_04920 GBS58_05170 GBV53_02660 GBV54_02980 GBV60_01030 GBW03_08275 GBW44_02945 GBW52_02660 GBW76_09425 GBX12_06105 GBX20_05150 GBX46_02975 GBX55_02170 GBX64_02960 GBY13_05500 GBY23_06830 GBY73_02670 GBZ51_08195 GBZ55_16220 GJE27_01095 GJE28_01030 GNA59_001534 GNA88_002071 GNA97_002206 GNA99_001774 GNB28_002987 GNB36_003850 GNB86_000454 GNC11_000532 GNC19_000532 GNC45_000531 GNC75_000532 GNC95_000533 GND07_000178 GT380_07915 GTH60_01975 GTH62_07070 GTH63_00600 GTH66_05180 GTH67_12240 GTH68_06600 GTH70_14735 GTH72_17180 GTH73_01035 GTH75_01105 GTH77_05615 GTH78_02970 GTH79_12330 GTH81_04780 GTH85_01035 GTH87_00455 GTH89_03570 GTH90_08220 GTH91_01095 GTH93_01105 GTH94_07600 GTH99_05625 GYI58_08080 GYI62_000474 GYI77_03080 GYJ04_00580 GYJ24_19520 GYJ27_08315 GYJ30_01035 GYJ32_01090 GYJ53_02715 GYJ59_02715 GYJ60_02700 G0A05_10640 G0A28_14155 G0A32_08125 G0A39_02720 G0A43_01500 G0A44_03460 G0A46_00470 G0A50_02720 G0A51_02720 G0A52_08080 G0A53_05440 G0A56_07595 G0A58_02415 G0A60_02720 G0A61_02720 G0A63_09525 G0A66_03425 G0A67_02720 G0A68_09730 G0A70_03335 G0A73_02700 G0A76_01555 G0A79_02720 G0A85_22685 G0A88_10635 G0A92_02435 G0A96_02755 G0A97_02720 G0A99_23650 G0B03_02740 G0B05_00630 G0B07_11055 G0B08_02745 G0B12_06665 G0B96_03080 G0C03_02255 G0C04_03855 G0C34_02775 G0E15_02045 G0E20_16880 G0G84_08415 G0J24_09830 G0J26_02730 G0J27_03690 G0J28_02740 G0J31_10575 G0J33_02575 G0J34_03800 G0J36_02745 G0J37_12525 G0J40_02745 G0J43_11285 G0J44_02745 G0J45_02745 G0J46_03315 G0J47_03800 G0J49_03790 G0J50_06640 G0J51_02735 G0J53_01085 G0J55_03315 G0J58_02745 G0J59_08075 G0J62_18425 G0J65_15310 G0J66_01070 G0J67_04115 G0J69_01085 G0J71_01085 G0J73_08740 G0J76_01095 G0J79_07045 G0J81_01085 G0J82_12040 G0J85_01085 G0J89_09970 G0J92_08080 G0J94_09220 G0J96_15275 G0J97_01085 G0K00_02740 G0K02_02725 G0K03_02745 G0K04_07530 G0K05_02045 G0K07_01085 G0K10_06230 G0K13_02035 G0K15_03345 G0K16_14950 G0K18_03040 G0K19_05110 G0K20_04135 G0K23_02735 G0K25_02320 G0K26_01070 G0K28_15840 G0K30_04765 G0K31_04100 G0K32_06830 G0K33_01805 G0K37_02160 G0K38_19380 G0K39_09670 G0K41_19360 G0K42_05610 protein protein saltm Salmonella typhimurium MMALRTLSALPVFADSLFSDRFNRIDRLFSQLTGDTPVAATPAYDLQKRDANNYLLTVSVPGWKEEELEIETVGGNLNITGKHTEETVEDQTHWIYRGIRKADFQLSFSLPEHAKVNNAKLEQGLLLVEIYQEIPESEKPKKIAIESKPKAIEHKS mint C740236EACA43B7E agsa-agsa 4 AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint Surprisingly, apart from spherical oligomers, AgsS was found to exist as fibrils after incubation at temperatures ranging from 20 °C to 65 °C. F1a f1b f1c f1d f4a ins-ins-1 4 Insulin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Insulin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint In the absence of AgsA, DTT-treated insulin formed large aggregates at both 37 °C and 42 °C (Fig. 4A). f4a ins-ins-2 5 Insulin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Insulin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4b mint Insulin forms fibrils agsa-agsa-1 5 AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint AgsA forms fibrils F4b sf1 agsa-ins 5 AgsA 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Insulin 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F4b mint the mixture of AgsA and Dtt-treated Insulin incubated at 42 °C, were analyzed by SEC followed by comassie Brilliant Blue staining. Results in Fig.4B indicate that these particles are complexes formed between AgsA and Insulin. agsa-agsa-2 1 AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint Such an increase was also observed by quantitative measurements of twelve randomly selected fibrils at both 30 °C and 42 °C using cryo-electron tomography (Fig. 1, G and H). The actual data of these selected fibrils, i.e. their length and diameter, are presented in Supplementary Table 1. f1g f1h st1 agsa-agsa-3 2 AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f2a f2b mint Data in this study demonstrate that the fibrils formed by AgsA are probably not amyloids. Results in Fig. 2A obtained from ThT fluorescence assay show a lack of increase in the fluorescence emission intensity at 490 nm when ThT was incubated with the AgsA fibrils formed at different temperatures. In contrast, a significant increase of fluorescence intensity was observed with amyloids of insulin, a molecule known to readily form amyloids, which bind to ThT, in vitro under harsh conditions [17]. Also, no binding of CR to the AgsA fibrils was observed (see Fig. 2B). ins-ins-3 2 Insulin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Insulin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint Data in this study demonstrate that the fibrils formed by AgsA are probably not amyloids. Results in Fig. 2A obtained from ThT fluorescence assay show a lack of increase in the fluorescence emission intensity at 490 nm when ThT was incubated with the AgsA fibrils formed at different temperatures. In contrast, a significant increase of fluorescence intensity was observed with amyloids of insulin, a molecule known to readily form amyloids, which bind to ThT, in vitro under harsh conditions [17]. Also, no binding of CR to the AgsA fibrils was observed (see Fig. 2B). f2a agsa-agsa-4 3 AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified AgsA 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f2c mint In addition, Far-UV CD analysis showed that AgsA fibrils probably possess a somewhat lesser content of β-sheet than AgsA oligomers (see Fig. 2C). The results of Far-UV CD analysis showed that the spectra of AgsA solutions were characteristic of β-sheet structure, as indicated by a peak at 194 nm and a trough at 216 nm,