UniProt UniProt http://www.uniprot.org hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. J. Biol. Chem. (0021-9258) 2011 mimix curation Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org 14-Mar-2012: Contacted by JYOTI. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org Accepted 2011-DEC-19 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mimix curation hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. J. Biol. Chem. (0021-9258) 2011 mimix curation Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org 14-Mar-2012: Contacted by JYOTI. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org Accepted 2011-DEC-19 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mimix curation hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. J. Biol. Chem. (0021-9258) 2011 mimix curation Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org 14-Mar-2012: Contacted by JYOTI. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org Accepted 2011-DEC-19 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mimix curation hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. J. Biol. Chem. (0021-9258) 2011 mimix curation Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org 14-Mar-2012: Contacted by JYOTI. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org Accepted 2011-DEC-19 by JYOTI J. Biol. Chem. (0021-9258) 2011 mimix curation hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. hSWS1{middle dot}SWSAP1 Is an Evolutionarily Conserved Complex Required for Efficient Homologous Recombination Repair. J. Biol. Chem. (0021-9258) 2011 mimix curation Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org 14-Mar-2012: Contacted by JYOTI. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down anti tag western anti tag western blot anti tag western Liu T., Wan L., Wu Y., Chen J., Huang J. I have not curated all possible interactions described in fig1a since it is impossible to ascertain the gene/protein identified jchen8@mdanderson.org Accepted 2011-DEC-19 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mimix curation ra51d_human DNA repair protein RAD51 homolog 4 R51H3 RAD51-like protein 3 TRAD RAD51D RAD51L3 RAD51 homolog D protein protein human Homo sapiens Human MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT DIP protein O75771 original sequence version: 130 6038DA9356DF354A ra51b_human DNA repair protein RAD51 homolog 2 RAD51L1 RAD51B REC2 RAD51 homolog B RAD51-like protein 1 protein protein human Homo sapiens Human MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF DIP protein O15315 original sequence version: 118 DB0B9AE82F44A52B rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD DIP protein Q06609 original sequence version: 154 DIP protein Q06609 original sequence version: 145 DIP protein Q06609 original sequence version: 122 DIP protein Q06609 original sequence version: 121 DIP protein Q06609 original sequence version: 125 DIP protein Q06609 original sequence version: 123 DIP protein Q06609 original sequence version: 144 DIP protein Q06609 original sequence version: 167 DIP protein Q06609 original sequence version: 169 26578E6206DEDEDA ra51c_human DNA repair protein RAD51 homolog 3 RAD51 homolog C RAD51C RAD51L2 RAD51-like protein 2 protein protein human Homo sapiens Human MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEEL DIP protein O43502 original sequence version: 118 3AAADD3C1C0851E0 xrcc3_human DNA repair protein XRCC3 XRCC3 X-ray repair cross-complementing protein 3 protein protein human Homo sapiens Human MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH DIP protein O43542 original sequence version: 119 4DDF3B163C3B3332 swap1_human ATPase SWSAP1 SWSAP1 C19orf39 SWIM-type zinc finger 7-associated protein 1 SWS1-associated protein 1 ZSWIM7-associated protein 1 protein protein human Homo sapiens Human MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP AB940178B7A4A6C6 zswm7_human Zinc finger SWIM domain-containing protein 7 ZSWIM7 SWS1 SWIM domain-containing and Srs2-interacting protein 1 homolog SWIM-type zinc finger domain-containing protein 7 protein protein human Homo sapiens Human MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGSSATQALDLVDRQSITLISSPSGRRVYQVLGSSSKTYTCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA 4DECCC679C537F18 zswim7-c19orf39 4 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association fig 1a c19orf39-zswim7 3 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association fig 1d and fig 2d zswim7-c19orf39-1 3 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association fig 1e and fig 2b and fig s3 c19orf39-zswim7-1 2 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association fig 1f zswim7-c19orf39-2 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association fig 1g c19orf39-zswim7-2 5 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association fig 1d c19orf39-zswim7-3 1 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association fig 1i c19orf39-rad51 3 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association fig 4g c19orf39-rad51b 3 11 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association fig 4g c19orf39-rad51c 3 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association fig 4g c19orf39-rad51d 3 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association fig 4g c19orf39-xrcc3 3 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association fig 4g rad51-c19orf39 5 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association fig 4h rad51b-c19orf39 5 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association fig 4h rad51c-c19orf39 5 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association fig 4g rad51d-c19orf39 5 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association fig 4h xrcc3-c19orf39 5 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association fig 4h rad51d-zswim7 5 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association fig S2a xrcc3-zswim7 5 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association fig S2a