IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. J. Biol. Chem. (0021-9258) 2011 imex curation Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn Accepted 2011-NOV-16 by MGT 21-Dec-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. J. Biol. Chem. (0021-9258) 2011 imex curation Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn Accepted 2011-NOV-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. J. Biol. Chem. (0021-9258) 2011 imex curation Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn Accepted 2011-NOV-16 by MGT 21-Dec-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. J. Biol. Chem. (0021-9258) 2011 imex curation Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn Accepted 2011-NOV-16 by MGT 21-Dec-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation ssra_peptide SSRA peptide tag peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) AANDENYALAA suc-ly-amc N-succinyl-Leu-Tyr-7-amido-4-methylcoumarin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) clpp_staaw ATP-dependent Clp protease proteolytic subunit clpP Endopeptidase Clp MW0730 protein protein staaw Staphylococcus aureus (strain MW2) MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK 811110E32846625E clpp-1 2 7 unspecified role unspecified role neutral component neutral component P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain M GSM Wed May 02 15:52:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1gly_ser_met' Wed Jun 13 18:48:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' Tue Jun 30 17:33:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' direct interaction direct interaction Fig.1A, Supp. fig. 1A clpp-2 2 7 unspecified role unspecified role neutral component neutral component P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain M GSM Wed May 02 15:16:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1gly_ser_met' Wed Jun 13 17:31:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' Tue Jun 30 17:36:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' direct interaction direct interaction Fig.1A clpp-3 2 7 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Fig.1A clpp-4 2 7 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Fig.1A, Supp Fig. 1B clpp-suc_ly_amc 1 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage Fig.1B clpp-suc_ly_amc-1 1 7 enzyme enzyme unspecified role unspecified role P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain M GSM Wed May 02 20:18:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1gly_ser_met' Wed Jun 13 18:41:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' Tue Jun 30 17:27:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage Fig.1B clpp-suc_ly_amc-2 1 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage Fig.1B clpp-ssra 4 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme unspecified role unspecified role P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain M GSM Wed May 02 15:55:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1gly_ser_met' Wed Jun 13 18:13:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' Tue Jun 30 16:08:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage Fig.1C clpp-ssra-1 4 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage Fig.1C clpp-1 3 7 unspecified role unspecified role neutral component neutral component P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain M GSM Wed May 02 16:10:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1gly_ser_met' Wed Jun 13 18:43:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' Tue Jun 30 17:20:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1delinsGlySerMet' direct interaction direct interaction Table 1 2.28A Rworking = 22.4% Rfree = 26.9% clpp-5 2 7 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Fig.1A, Supp. Fig. 1B Under high salt conditions the tetradecameric structure becomes heptameric.