MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. FEBS Lett. (0014-5793) 2011 imex curation Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. suggested by lperfetto Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. FEBS Lett. (0014-5793) 2011 imex curation Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. suggested by lperfetto Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs predetermined predetermined participant predetermined Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. FEBS Lett. (0014-5793) 2011 imex curation Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. suggested by lperfetto Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation ssr5_mouse Somatostatin receptor type 5 Sstr5 Smstr5 protein protein mouse Mus musculus Mouse MEPLSLTSTPSWNASAASSSSHNWSLVDPVSPMGARAVLVPVLYLLVCTVGLGGNTLVIYVVLRYAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVSYWPFGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKLASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRRSERKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKALCLRRGYGVEDADAIEPRPDKSGRPQTTLPTRSCEANGLMQTSRL mint Receptor for somatostatin-28. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase C069149B8A8141C4 zdhc5_mouse Palmitoyltransferase ZDHHC5 Zdhhc5 Kiaa1748 Zinc finger DHHC domain-containing protein 5 protein protein mouse Mus musculus Mouse MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLNVSPAVPIYNAIMFLFVLANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSLEITESQSADAEPPPPPKPDLSRYTGLRTHLSLATNEDSSLLGKDSPPTPTMYKYRPGYSSSSTSAAMPHSSSAKLSRGDSLKEPTSIADSSRHPSYRSEPSLEPESFRSPTFGKSFHFDPLSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSPDFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLLPTGPPHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLAGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLSKTPLGRPAVPRFGKPDGLRSRGLGSPEPGTTAPYLGRSISYSSQKAPSGVSETEEVALQPLLTPKDEVQLKTTYSKSNGQPKSIGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV mint 6FD8E83FA3D3F961 ssr5_rat Somatostatin receptor type 5 Sstr5 protein protein rat Rattus norvegicus (Rat) Rat MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIYVVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRRSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQTSRI mint Receptor for somatostatin-28. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase 4BD4512960613B4A sstr5-zdhhc5 2 ZDHHC5 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SSTR5 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain helix 8 region fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b homomint mint sstr5-zdhhc5-1 1 ZDHHC5 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SSTR5 4 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f2 homomint mint sstr5-zdhhc5-2 3 ZDHHC5 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain TM1-TM2 gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SSTR5 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1c f1d homomint mint