IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of a Key Intermediate of the SMN Complex Reveals Gemin2's Crucial Function in snRNP Assembly. Structure of a Key Intermediate of the SMN Complex Reveals Gemin2's Crucial Function in snRNP Assembly. Cell (0092-8674) 2011 imex curation Zhang R., So B.R., Li P., Yong J., Glisovic T., Wan L., Dreyfuss G. Interactions involving U4 RNA could not be entered as the sequence of this molecule could not be traced. gdreyfuss@hhmi.upenn.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang R., So B.R., Li P., Yong J., Glisovic T., Wan L., Dreyfuss G. Interactions involving U4 RNA could not be entered as the sequence of this molecule could not be traced. gdreyfuss@hhmi.upenn.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation EBI-4325694 and EBI-4325704:-The "sufficient to bind" region for Smn entered is 26-62 - but this region is not used in fig 1 (only in 5C) - aa's 1-194 were used here. > Corrected For both Fig 1 or 5C, I can see that they detected SMN/Gemin2 and D1/D2 - but as proteins "F/E/G" only form one blob on the gel,- even on the large image, I dont see how these proteins (F/E/G) can be entered as interactors? > I'm inclined to leave them as ia, as they the author has shown a E/F/G only lane which has only that 'blob' on it, and he may well be able to discern bands on the original image which have not survived the publication process. EBI-4325673/EBI-435704- completely redone as I had right protein but wrong mutant on EBI-4325673 and missed the mutant completely on 435704.. Structure of a Key Intermediate of the SMN Complex Reveals Gemin2's Crucial Function in snRNP Assembly. Structure of a Key Intermediate of the SMN Complex Reveals Gemin2's Crucial Function in snRNP Assembly. Cell (0092-8674) 2011 imex curation Zhang R., So B.R., Li P., Yong J., Glisovic T., Wan L., Dreyfuss G. Interactions involving U4 RNA could not be entered as the sequence of this molecule could not be traced. gdreyfuss@hhmi.upenn.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang R., So B.R., Li P., Yong J., Glisovic T., Wan L., Dreyfuss G. Interactions involving U4 RNA could not be entered as the sequence of this molecule could not be traced. gdreyfuss@hhmi.upenn.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation EBI-4325694 and EBI-4325704:-The "sufficient to bind" region for Smn entered is 26-62 - but this region is not used in fig 1 (only in 5C) - aa's 1-194 were used here. > Corrected For both Fig 1 or 5C, I can see that they detected SMN/Gemin2 and D1/D2 - but as proteins "F/E/G" only form one blob on the gel,- even on the large image, I dont see how these proteins (F/E/G) can be entered as interactors? > I'm inclined to leave them as ia, as they the author has shown a E/F/G only lane which has only that 'blob' on it, and he may well be able to discern bands on the original image which have not survived the publication process. EBI-4325673/EBI-435704- completely redone as I had right protein but wrong mutant on EBI-4325673 and missed the mutant completely on 435704.. Structure of a Key Intermediate of the SMN Complex Reveals Gemin2's Crucial Function in snRNP Assembly. Structure of a Key Intermediate of the SMN Complex Reveals Gemin2's Crucial Function in snRNP Assembly. Cell (0092-8674) 2011 imex curation Zhang R., So B.R., Li P., Yong J., Glisovic T., Wan L., Dreyfuss G. Interactions involving U4 RNA could not be entered as the sequence of this molecule could not be traced. gdreyfuss@hhmi.upenn.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang R., So B.R., Li P., Yong J., Glisovic T., Wan L., Dreyfuss G. Interactions involving U4 RNA could not be entered as the sequence of this molecule could not be traced. gdreyfuss@hhmi.upenn.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation EBI-4325694 and EBI-4325704:-The "sufficient to bind" region for Smn entered is 26-62 - but this region is not used in fig 1 (only in 5C) - aa's 1-194 were used here. > Corrected For both Fig 1 or 5C, I can see that they detected SMN/Gemin2 and D1/D2 - but as proteins "F/E/G" only form one blob on the gel,- even on the large image, I dont see how these proteins (F/E/G) can be entered as interactors? > I'm inclined to leave them as ia, as they the author has shown a E/F/G only lane which has only that 'blob' on it, and he may well be able to discern bands on the original image which have not survived the publication process. EBI-4325673/EBI-435704- completely redone as I had right protein but wrong mutant on EBI-4325673 and missed the mutant completely on 435704.. ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN DIP protein P62304 original sequence version: 64 DIP protein P62304 original sequence version: 87 DIP protein P62304 original sequence version: 73 DIP protein P62304 original sequence version: 123 7D8881CE1F4FA2FD smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR DIP protein P62314 original sequence version: 77 DIP protein P62314 original sequence version: 100 DIP protein P62314 original sequence version: 86 DIP protein P62314 original sequence version: 135 0C81C94BF98E0810 gemi2_human Gem-associated protein 2 GEMIN2 SIP1 Component of gems 2 Survival of motor neuron protein-interacting protein 1 protein protein human Homo sapiens Human MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS DIP protein O14893 original sequence version: 146 DIP protein O14893 original sequence version: 114 3232F410EA98EB81 smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B ruxf_human Small nuclear ribonucleoprotein F SNRPF PBSCF Sm protein F protein protein human Homo sapiens Human MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE DIP protein P62306 original sequence version: 64 DIP protein P62306 original sequence version: 84 DIP protein P62306 original sequence version: 73 DIP protein P62306 original sequence version: 120 416B88D575DAE58A smd2_human Small nuclear ribonucleoprotein Sm D2 SNRPD2 snRNP core protein D2 SNRPD1 protein protein human Homo sapiens Human MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK DIP protein P62316 original sequence version: 74 DIP protein P62316 original sequence version: 97 DIP protein P62316 original sequence version: 83 DIP protein P62316 original sequence version: 134 D986059D82B7E045 ruxg_human Small nuclear ribonucleoprotein G SNRPG PBSCG Sm protein G protein protein human Homo sapiens Human MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV DIP protein P62308 original sequence version: 69 DIP protein P62308 original sequence version: 92 DIP protein P62308 original sequence version: 78 DIP protein P62308 original sequence version: 126 623302BF6BE758FE smn1-sip1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1 smn1-sip1-1 2 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Figs. 1, 5C sip1-smn1 2 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1 smn1-sip1-2 2 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait O14893:p.Tyr52Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y D Wed May 02 19:46:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr52asp' Tue Jun 30 16:21:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr52Asp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Figs. 1, 5C Gemin2 Tyr52Asp impairs Gemin2-pentamer interaction. sip1-smn1-1 3 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Table 1 2.5A Rworking 25.7% Rfree 33.1% sip1-smn1-2 1 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16637:p.Asp44Val mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D V Wed May 02 14:39:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp44val' Tue Jun 30 15:42:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp44Val' in vitro In vitro 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6C smn1-sip1-3 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey O14893:p.Arg213Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 19:16:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg213asp' Tue Jun 30 18:10:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg213Asp' in vitro In vitro direct interaction direct interaction Fig 6D