MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A protein oxidase catalysing disulfide bond formation is localized to the chloroplast thylakoids. A protein oxidase catalysing disulfide bond formation is localized to the chloroplast thylakoids. FEBS J. (1742-464X) 2011 imex curation Feng WK., Wang L., Lu Y., Wang XY. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Feng WK., Wang L., Lu Y., Wang XY. FEBS J. (1742-464X) 2011 Only protein-protein interactions imex curation psad1_arath Photosystem I reaction center subunit II-1, chloroplastic psaD1 Photosystem I 20 kDa subunit 1 T5J8.7 At4g02770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATQAAGIFNSAITTAATSGVKKLHFFSTTHRPKSLSFTKTAIRAEKTDSSAAAAAAPATKEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL 92F1667DDE0CB713 lto1_arath Thiol-disulfide oxidoreductase LTO1 LTO1 Protein LUMEN THIOL OXIDOREDUCTASE 1 Vitamin K reductase F8D20.270 At4g35760 VKOR protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMARFVSVSSCQFHFGFREVSPPSVTSYPRRFEVSDRRFPAIPIKCSSSEPENGEDSAPSLSSSSSSSTSEVSTSNSSTYNWYTGIGGIGMLDTAYLTYLKVTGSDAFCPIGGGTCGDVLNSDYAVVFGVPLPVIGFVMYGVVTALSAELGEGNLPFGISKSNGRFALFGITTAMASASAYFLYILSTKLSGSSCLYCLVSAFLSFSLFFLSVKDVKLQEIQQVVGLQICLAIIVVASLTASYSTAQPIPSRSGDIELPYFRTEISSSSSPYAIALAKHLNSIGAKMYGAFWCSHCLEQKEMFGREAAKELNYVECFPDGYKKGTKILKACADAAIEGFPTWIINDKVLSGEIELAELAEMTGFSLDQANETNQLQ mint 21D60947ADCB6D95 psad1-q8l540 1 AtVKOR-DsbA 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined D1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f2 mint