MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. EMBO Rep. (1469-221X) 2011 imex curation Kaur J., Stuart RA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kaur J., Stuart RA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. EMBO Rep. (1469-221X) 2011 imex curation Kaur J., Stuart RA. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Kaur J., Stuart RA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. EMBO Rep. (1469-221X) 2011 imex curation Kaur J., Stuart RA. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Kaur J., Stuart RA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation rm49_yeast 54S ribosomal protein MRP49, mitochondrial MRP49 Mitochondrial large ribosomal subunit protein mL61 YKL631 YKL167C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKVAQQLKFLNKISATTRLPQILVDPKKYSGLRLTFQTKNHNGHMGARVFWHNYLPTLQFYNPRMKFDVIRIKNEDKQKSVPCKLEILSHEGSVVETIDMRNKMHEDIMKDLLDKIEHVPLPENEIIRVGPQESII 34176EEAC91A14CD rm41_yeast 54S ribosomal protein L41, mitochondrial MRP20 MRPL41 YDR405W D9509.23 YmL41 Mitochondrial large ribosomal subunit protein uL23m protein protein yeast Saccharomyces cerevisiae Baker's yeast MPRLTVGTKNMLYPLQKTLAVGSCKPEQVPIRSLASVVESSSKILDKSGSDREVDINVSEKIYKWTKAGIEQGKEHFKVGGNKVYFPKARIILLRPNAKHTPYQAKFIVPKSFNKLDLRDYLYHIYGLRAMNITTQLLHGKFNRMNLQTTRFREPQIKKMTIEMEEPFIWPEEPRPDENSFWDSTTPDNMEKYREERLNCLGSDANKPGTAFDGVVGPYERVAQPFIPRFLKREIDNKRERHAAELQRADKLIALNRYIEDLH B8B1E51BAC60C673 B8B1E51BAC60C673 rm27_yeast 54S ribosomal protein L27, mitochondrial MRPL27 YBR282W YBR2019 YmL27 Mitochondrial large ribosomal subunit protein mL41 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKGSPISQFSKTSINALTRPWKKYRDGELFYGLSKVGNKRVPLTTKQGNKTMYKGTRASGIGRHTKFGGYVINWKKVRTYVTPDMVNFELKPYVNANVPPLKHEFKGFSGGPLDPRLQLLKIKEYIVNGRVQSEGATDTSCYKERG 0BB2E6D8A0E49213 0BB2E6D8A0E49213 prx1_yeast Peroxiredoxin PRX1, mitochondrial PRX1 1-Cys PRX Mitochondrial thiol peroxidase Thioredoxin peroxidase YBL0503 YBL0524 YBL064C Glutaredoxin-dependent peroxiredoxin Glutathione-dependent peroxiredoxin protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDADTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDEAKAKFGQFNEIKPYLRFTKSK F611A9ED85E4681A F611A9ED85E4681A rm02_yeast 54S ribosomal protein L2, mitochondrial MRP7 MRPL2 YmL2 YMR6 N2007 YNL005C Mitochondrial large ribosomal subunit protein bL27m protein protein yeast Saccharomyces cerevisiae Baker's yeast MWNPILLDTSSFSFQKHVSGVFLQVRNATKRAAGSRTSMKDSAGRRLGPKKYEGQDVSTGEIIMRQRGTKFYPGENVGIGKDHSIFALEPGVVRYYLDPFHPKRKFIGVALRRDLKLPSPHFEPTVRRFGRFELTNKRAAYKEENSISRKDYLAKPNILKQLEVRESKRKELQDKLSKVLRDELKLDIKDIELATSYLIRVRASLKNGYPIEDARFNSRYYLKEEERLKARRESWTNEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEKQALKAKLLEDLEKSQHLETKKDKNYIKALFKDACNFLTLSEEVHLRRKYLKSVFPETDSTVETKSGKKSIVSRRFDYTKNKVEVIARSRRAFLSKL F8F17EF955BB7ACF F8F17EF955BB7ACF rm04_yeast 54S ribosomal protein L4, mitochondrial MRPL4 YLR439W L9753.1 YmL4 Mitochondrial large ribosomal subunit protein uL29m protein protein yeast Saccharomyces cerevisiae Baker's yeast MWKRSFHSQGGPLRARTKFTKPKPKQPVLPKDKIRPPTQLTHHSNNLRITEPIPPTTSNLRCPDDHPLWQFFSNKKFIRSADDLPPSSHIRPWSIPELRHKSFNDLHSLWYNCLREQNVLARENHLLKNIVGSTHDEFSELSNSIRTTMWQIRHVLNERELAYSASREFLQDESERKKFLDTLANDYFLNKDIPDDEVASMLTRFQLAIFGISETIQDNTVDINFIDGIKFLANLKLQRFKDSNDLISEISQEPITDVGESFILFTSDFEPHAVQEACVAIKDLRKSPDNKVPKLDELPTVRKYLKQLIHASSVEQATA 2DE880E9BFE19BC9 2DE880E9BFE19BC9 rm40_yeast 54S ribosomal protein L40, mitochondrial YPL173W MRPL40 YmL40 Mitochondrial large ribosomal subunit protein uL24m protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGSYQHLSNVGSRVMKRLGNRPKNFLPHSEKFIKKSTPEFMKSDLKEVDEKTSFKSEKEWKFIPGDRVVVMSGASKGNIAVIKSFDKRTNSFILDENGPTKTVPVPKQFWLEGQTSHMITIPVSILGKDLRLVADIDDEKTPGKTRTVAVRDVSFNGSYYDADYKKVMPYRCVKGQPDLIIPWPKPDPIDVQTNLATDPVIAREQTFWVDSVVRNPIPKKAIPSIRNPHSKYKRGTLTAKDIAKLVAPEMPLTEVRKSHLAEKKELAEREVPKLTEEDMEAIGARVFEFLEKQKRE D5BB2B7AE13ECBF9 D5BB2B7AE13ECBF9 rm36_yeast 54S ribosomal protein L36, mitochondrial MRPL36 YBR122C YBR0918 YmL36 Mitochondrial large ribosomal subunit protein bL31m protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRRSQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSSETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK 7A8DF86EE899B848 7A8DF86EE899B848 rm25_yeast 54S ribosomal protein L25, mitochondrial MRPL25 YMR26 YGR076C YmL25 Mitochondrial large ribosomal subunit protein mL59 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYKQYFDSLPLKLKSFFQRYPPSIKYSPVSTSTKAINANPFLPNKHPVTQRFHDPKYSLRRMSDVYKLALRYGVEEFLPPIENTKKLFFEEKYNKKTLMKGVLLPKGHKHELKLNEKLKKREEALKKVDELIASKKGSKYAKRVEKMKKNQSIGWF DAB3B47998D6CEEB DAB3B47998D6CEEB mrp20-mrp49 2 MRP49 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL36 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f2b mint mrp20-mrpl4 2 MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f2d mint mrp20-mrpl4-1 1 MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PRX1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f3d mint mrp20-mrpl25 1 MRPL27 6 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP20 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL40 10 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL25 12 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PRX1 7 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL4 9 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association mint f3c st1 mrp20-mrpl4-2 1 MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association mint f3f sf3b mrpl25-mrp20 1 MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL25 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MRPL20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association f3f mint mrpl27-mrp20 1 MRPL4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL27 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association f3f mint prx1-mrp20 1 MRPL4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL36 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP49 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PRX1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f3g mint mrp20-mrpl40 1 MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association sf2 mint mrp20-mrpl36 3 MRP20 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MRPL36 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPL40 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f4a mint To address whether this complex is membrane tethered in the absence of stable 54S assembly, mrp20DC mitochondria were subjected to a mild sonication treatment under low-salt conditions, followed by low-speed centrifugation to recover the mitochondrial membranes (Fig 4A). The ribosomal proteins, such as Mrp20DC, MrpL40 and MrpL36, all cofractionated with the inner-membrane marker, the ADP/ATP carrier protein and in a salt-sensitive manner.