MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Misfolded PrP impairs the UPS by interaction with the 20S proteasome and inhibition of substrate entry. Misfolded PrP impairs the UPS by interaction with the 20S proteasome and inhibition of substrate entry. EMBO J. (0261-4189) 2011 imex curation Deriziotis P., André R., Smith DM., Goold R., Kinghorn KJ., Kristiansen M., Nathan JA., Rosenzweig R., Krutauz D., Glickman MH., Collinge J., Goldberg AL., Tabrizi SJ. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Deriziotis P., André R., Smith DM., Goold R., Kinghorn KJ., Kristiansen M., Nathan JA., Rosenzweig R., Krutauz D., Glickman MH., Collinge J., Goldberg AL., Tabrizi SJ. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Misfolded PrP impairs the UPS by interaction with the 20S proteasome and inhibition of substrate entry. Misfolded PrP impairs the UPS by interaction with the 20S proteasome and inhibition of substrate entry. EMBO J. (0261-4189) 2011 imex curation Deriziotis P., André R., Smith DM., Goold R., Kinghorn KJ., Kristiansen M., Nathan JA., Rosenzweig R., Krutauz D., Glickman MH., Collinge J., Goldberg AL., Tabrizi SJ. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] pull down pull down western blot western blot Immuno blot Immuno blot Deriziotis P., André R., Smith DM., Goold R., Kinghorn KJ., Kristiansen M., Nathan JA., Rosenzweig R., Krutauz D., Glickman MH., Collinge J., Goldberg AL., Tabrizi SJ. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation psmd6_mouse 26S proteasome non-ATPase regulatory subunit 6 26S proteasome regulatory subunit S10 p42A Psmd6 26S proteasome regulatory subunit RPN7 protein protein mouse Mus musculus Mouse MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVREELMAAVRENNMAPYYEALCKSLDWQMDVDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAIVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVDFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM DC8C54144D2884B9 prs7_human 26S proteasome regulatory subunit 7 PSMC2 MSS1 Proteasome 26S subunit ATPase 2 Protein MSS1 26S proteasome AAA-ATPase subunit RPT1 protein protein human Homo sapiens Human MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN DIP protein P35998 original sequence version: 158 DIP protein P35998 original sequence version: 109 85FD95F6DF7A3E84 prs7_mouse 26S proteasome regulatory subunit 7 Proteasome 26S subunit ATPase 2 Protein MSS1 Psmc2 Mss1 26S proteasome AAA-ATPase subunit RPT1 protein protein mouse Mus musculus Mouse MPDYLGADQRKTKEEEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN 302E4FA62A48104C prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG DIP protein P04925 original sequence version: 157 DIP protein P04925 original sequence version: 140 DIP protein P04925 original sequence version: 122 DIP protein P04925 original sequence version: 117 DIP protein P04925 original sequence version: 132 DIP protein P04925 original sequence version: 128 D5331E6321826CC0 psmd6_human 26S proteasome non-ATPase regulatory subunit 6 PSMD6 KIAA0107 PFAAP4 26S proteasome regulatory subunit S10 p42A Proteasome regulatory particle subunit p44S10 Phosphonoformate immuno-associated protein 4 Breast cancer-associated protein SGA-113M 26S proteasome regulatory subunit RPN7 protein protein human Homo sapiens Human MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM 8843E6684AE91ACD prnp-psmc2 1 Rpt1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Prp 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Rpn7 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified association association f2c homomint domino mint Full-length recombinant mouse PrP (aa23-231) was folded into either an a-helical structure representative of native PrPC (a-PrP), or a predominantly b-sheet species, termed b-PrP, that has similar physico-chemical properties to PrPSc (Jackson et al, 1999b), as described previously (Kristiansen et al, 2007). To determine whether PrP interacts directly with the 26S proteasome, we incubated purified human 26S particles with aggregated b-PrP and then added anti-PrP Abcoated beads. 20S proteasome and 19S components (Rpt1 and Rpn7) were precipitated by the anti-PrP antibody (Figure 2C). prnp-psmd6 2 Prp 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Rpn7 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf2 homomint mint We observed that PrP co-immunoprecipitated both the 20S particle and the 19S subunit, Rpt1, in RML prion-infected mouse brain (Figure 2A). It could also be seen to co-immunoprecipitate another 19S subunit, Rpn7 (Supplementary Figure S2). prnp-psmc2-1 2 Rpt1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Prp 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association f2a mint We observed that PrP co-immunoprecipitated both the 20S particle and the 19S subunit, Rpt1, in RML prion-infected mouse brain (Figure 2A). It could also be seen to co-immunoprecipitate another 19S subunit, Rpn7 (Supplementary Figure S2).