MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.). Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.). FEBS J. (1742-464X) 2011 Mittal D., Enoki Y., Lavania D., Singh A., Sakurai H., Grover A. onion-epidermis Allium cepa epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Mittal D., Enoki Y., Lavania D., Singh A., Sakurai H., Grover A. FEBS J. (1742-464X) 2011 Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.). Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.). FEBS J. (1742-464X) 2011 Mittal D., Enoki Y., Lavania D., Singh A., Sakurai H., Grover A. in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mittal D., Enoki Y., Lavania D., Singh A., Sakurai H., Grover A. FEBS J. (1742-464X) 2011 Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.). Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.). FEBS J. (1742-464X) 2011 Mittal D., Enoki Y., Lavania D., Singh A., Sakurai H., Grover A. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mittal D., Enoki Y., Lavania D., Singh A., Sakurai H., Grover A. FEBS J. (1742-464X) 2011 q69wi0_orysj P0531C01.10 P0577H07.18 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MVVPRCVLEHDTMEKVDNRRGKQEKNWERRWQELGPLRERTPGWLDATGRGPPSFSTPMSYGVEEGRGPRSDGSHCCRDLGADAKDLSGAVATAGEEGAPEDDQAALAAAVEPVVVVAVAIGGVTGGGAEQQTTRTQMQAMEERISAVEQKQQQMPMFLMRGMKNLGVLHMLIDRQNQHGENRELGDTLYMKCLRVPPRCNGPMMTPSPDIDSRPMITLSLSNFGVNSVIQPKFT mint 1346CF2D9F2A49F8 hfa2d_orysj Heat stress transcription factor A-2d HSFA2D HSF08 HSF7 Heat stress transcription factor 7 Heat stress transcription factor 8 OJ1607A12.12 OsJ_009160 Os03g0161900 LOC_Os03g06630 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MEKMMPGMVKEEWPPSSPEEGEAPRPMEGLHEVGPPPFLTKTFDLVADPATDGVVSWGRAGSSFVVWDPHVFAAVFLPRFFKHNNFSSFVRQLNTYGFRKIDPDRWEFANDGFLRGQRHLLKMIKRRRPLSYLPGSQQALGTCLEVGQFGLDEEIDRLKRDKNILLAEVVKLRHKQQSTKANMRAMEERLQHAEQKQVQMMGFLARAMQNPDFFHQLIHQQDKMKGLEDTFSKKRTRSIDIVPFLNPGEVSQGDQLESTLLFDPRPFAELNDEPAKSELENLALNIQGLGKGKQDVNRTRNQPRNQASNETELTDDFWEELLNEGARDDAGIPGMERRRPRYVDALAQKLGYLSNSSQK mint CCB81A4DA9981EE6 hfa2a_orysj Heat stress transcription factor A-2a HSFA2A HSF11 HSF4 Heat shock protein 41 Heat stress transcription factor 11 Heat stress transcription factor 4 RHSP2 OSJNBb0036F07.17 OsJ_012039 LOC_Os03g53340 Os03g0745000 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MNPLRVIVKEEELDFAAAAAAAAAGEGSPSSWAVGVMDLPRPMEGLGEAGPPPFLCKTYEVVDDPGTDTVISWGFAGNSFVVWDANAFAAVLLPRYFKHSNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGKKELLKTIKRRRPPPSSPPSSSSSSSSSQHQQQPAAACLEVGQFGRDGVVNRLQRDKSVLIAEVVKLRQEQQTTRAQMQAMEERISAAEQKQQQMTVFLARAMKNPGFLQMLVDRQAGQHGARNRVLEDALSKKRRRPIEYLLTRNGETCAAGESAAMLAADGVAEPDGDTTPRGDGGGGGGGDTESFWMQLLSLGLEEKQREDGVAGGVQESNSGGADVDNDEEDDDDDVDVLVQSIYHLSPK mint AA6BE37505D9023A hfb4b_orysj Heat stress transcription factor B-4b HSFB4B HSF12 HSF19 Heat stress transcription factor 12 Heat stress transcription factor 19 OJ1340_C08.141-1 P0524G08.108-1 OJ1340_C08.141-2 P0524G08.108-2 Os07g0640900 LOC_Os07g44690 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAFLVERCGEMVVSMEMGPHGGGGAAAGKPVPAPFLTKTYQLVDDPCTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAEIHRRKSSQPPPPPMPHQPYHHHHHLNPFSLPPPPPAYHHHHLIQEEPATTAHCTVAGDGGEGGDFLAALSEDNRQLRRRNSLLLSELAHMKKLYNDIIYFLQNHVAPVTTTTTTPSSTAMAAAQHHLPAAASCRLMELDSPDHSPPPPPPKTPATDGGDTVKLFGVSLHGRKKRAHRDDDDGVHDQGSEV mint 03913204F97CEA05 hsfa9_orysj Heat stress transcription factor A-9 HSFA9 HSF09 HSF8 Heat stress transcription factor 8 Heat stress transcription factor 9 OSJNBa0081P02.6 OsJ_009601 Os03g0224700 LOC_Os03g12370 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGSKKRSPQHPAAAAPPPAVGGGGGGEVSGDGGASTANGPVVPKPSEVAPFLTKVYDMVSDPATDNVISWAEGGGSFVIWDSHAFERDLHRHFKHSNFTSFIRQLNTYGFRKVHPDRWEWANEGFIMGQKHLLKTIKRRKKSSQESPSEIQKAPVKTAPGTENIEIGKYGGLEKEVETLKRDKALLMQQLVDLRHYQQTSNLEVQNLIERLQVMEQNQQQMMALLAIVVQNPSFLNQLVQQQQQQRRSNWWSPDGSKKRRFHALEQGPVTDQETSGRGAHIVEYLPPVPETSGQVNPVEGAICSANSQPVPSPAVATPMDMQTSNVADTLGSSEEPFADNSTLHEWDDNDMQLLFDDNLDPILPPFENDGQMGPPLSVQDYDFPQLEQDCLMEAQYNSNNPQYADVITEA mint DD076F9AEF1F3334 hfa2c_orysj Heat stress transcription factor A-2c HSFA2C HSF25 HSF6 Heat stress transcription factor 25 Heat stress transcription factor 6 OsJ_030304 Os10g0419300 LOC_Os10g28340 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MDPAAAGIVKEEMLESQQQQRQEDGGAAPRPMEGLHEVGPPPFLTKTYDLVEDPATDGVVSWSRAGNSFVVWDPHVFADLLLPRLFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKTIKRRKPPSNAPPSQQQSLTSCLEVGEFGFEEEIDRLKRDKNILITEVVKLRQEQQATKDHVKAMEDRLRAAEQKQVQMMGFLARAMRNPEFFQQLAQQKEKRKELEDAISKKRRRPIDNVPFYDPGETSQTEQLDSPYLFDSGVLNELSEPGIPELENLAVNIQDLGKGKVDEERQNQTNGQAELGDDFWAELLVEDFTGKEEQSELDGKIDGIDELAQQLGYLSSTSPK mint A6134CBB55469FC5 hfb4c_orysj Heat stress transcription factor B-4c HSFB4C HSF22 Heat stress transcription factor 22 P0025H07.19 Os09g0455200 LOC_Os09g28200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MERCGSWSDCEAAAAAAQKAVPAPFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSFVRQLNTYGFRKVVPERWEFANEFFRKGEKQLLTEIHRRKTSSASTASPSPPPFFAPPHFPLFHHPGVAAAQHHHAFVGDDGVVAAHGIGMPFPQPHWREPNLPVATRLLALGGPAPSPSSAEAGGAGRAATAAVLMEENERLRRSNTALLQELAHMRKLYNDIIYFVQNHVRPVAPSPAAAAFLQGLGMQARKKPAAANVLNNSGGSTTSSSSLTIAEEPSPPPQQQHLAGEKSGGEAGNSSAARSSAPTKLFGVHLSAAPCGAGSKRASSPEEHPPTSPATKPRLVLECDDLSLTVAPSSSSQQQLSAASSPTSTS mint 285EB08B8EAA847A hsfa2c 2 HSFA2C 9 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated Stoichiometry: 3.0 direct interaction direct interaction f2b mint hsfa9 2 HSFA9 8 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated Stoichiometry: 3.0 direct interaction direct interaction f2b mint hsfb4b 2 HSFB4B 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated Stoichiometry: 3.0 direct interaction direct interaction f2b mint hsfa2d-hsfb4b 3 HSFB4B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFA7 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint hsfa2a-hsfb4b 3 HSFA2A 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFB4B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint hsfb4b-hsfb4b 3 HSFB4B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFB4B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint hsfb4b-hsfb4c 3 HSFB4C 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFB4B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint hsfb4b-p0531c01_10 3 HSF26 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFB4B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint hsfa2c-hsfa2c 1 HSFA2C 9 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFA2C 9 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6a mint hsfb4b-hsfb4b-1 1 HSFB4B 7 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSFB4B 7 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6a mint