MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. EMBO J. (0261-4189) 2011 imex curation Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp Only protein-protein interactions human-kk-47-c2 Homo sapiens kk-47-c2 kk-47-c2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. EMBO J. (0261-4189) 2011 imex curation Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp Only protein-protein interactions human-kk-47-c2 Homo sapiens kk-47-c2 kk-47-c2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. EMBO J. (0261-4189) 2011 imex curation Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV DIP protein P26718 original sequence version: 106 C22F6BD533D7800E mica_human MHC class I polypeptide-related sequence A MICA PERB11.1 protein protein human Homo sapiens Human MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA DIP protein Q29983 original sequence version: 55 1FE084813DDA13A8 leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI DIP protein P17931 original sequence version: 132 DIP protein P17931 original sequence version: 181 C49DDF6D67AE0C88 mica-lgals3 2 MICA 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Galectin-3 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint sf12d mica-lgals3-1 1 Galectin-3 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MICA 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint We also confirmed that galectin-3 binds MICAC2 through poly-N-acetyllactosamine in YTS cells (Figure 4L).Binding of galectin-3 to MICAC2 was disrupted by endo-b-galactosidase treatment f4k f4l f5b klrk1-mica-2 3 MICA 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NKG2-D 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction homomint mint MICA carrying core2 O-glycans was designated MICAC2. We directly made a comparison of the binding affinity for NKG2D between MICA-IgG and MICAC2-IgG using a surface plasmon resonance-based biosensor. The affinity of MICAC2-IgG for NKG2D was lower than that of MICA-IgG (Supplementary Figure S14B), suggesting that the attachment of poly-N-acetyllactosamine to MICAC2 reduces the affinity of MICAC2 for NKG2D. G sf14b