IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. Cell (0092-8674) 2011 imex curation Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation We do not know from enzyme mutants if they disrupt/increase interaction, only the rate of the eventual reaction,so always added as mutant and effect added as comment. I could not work out where or what the 6A mutant is so added as comment to EBI-4319850 makes no difference to EBI-4319860. Figure legend corrected. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. Cell (0092-8674) 2011 imex curation Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. Recombinant full-length Pom1 bound phospholipids in vitro with significantly higher affinity after dephosphorylation. sophie.martin@unil.ch Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation We do not know from enzyme mutants if they disrupt/increase interaction, only the rate of the eventual reaction,so always added as mutant and effect added as comment. I could not work out where or what the 6A mutant is so added as comment to EBI-4319850 makes no difference to EBI-4319860. Figure legend corrected. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. Cell (0092-8674) 2011 imex curation Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation We do not know from enzyme mutants if they disrupt/increase interaction, only the rate of the eventual reaction,so always added as mutant and effect added as comment. I could not work out where or what the 6A mutant is so added as comment to EBI-4319850 makes no difference to EBI-4319860. Figure legend corrected. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. Cell (0092-8674) 2011 imex curation Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation We do not know from enzyme mutants if they disrupt/increase interaction, only the rate of the eventual reaction,so always added as mutant and effect added as comment. I could not work out where or what the 6A mutant is so added as comment to EBI-4319850 makes no difference to EBI-4319860. Figure legend corrected. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. Cell (0092-8674) 2011 imex curation Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation We do not know from enzyme mutants if they disrupt/increase interaction, only the rate of the eventual reaction,so always added as mutant and effect added as comment. I could not work out where or what the 6A mutant is so added as comment to EBI-4319850 makes no difference to EBI-4319860. Figure legend corrected. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. Cell (0092-8674) 2011 imex curation Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation We do not know from enzyme mutants if they disrupt/increase interaction, only the rate of the eventual reaction,so always added as mutant and effect added as comment. I could not work out where or what the 6A mutant is so added as comment to EBI-4319850 makes no difference to EBI-4319860. Figure legend corrected. 1-phosphatidyl-1d-myo-inositol 4-phosphate 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tea4_schpo Tip elongation aberrant protein Tea4 SPBC1706.01 tea4 wsh3 Cell polarity protein tea4 Win1-interacting SH3 domain protein protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLHMNSASSADSMEIMESHFDPTQQNDSTIIESRYSPEEYLEQSFEIQRIISGENSEPQTVASQEISDSQEEDTTLTSSQFEDCGTEYNEVVEDDEFRSEDEDDFMDEEEEYALYEAELSSSPSIHEEVIDCNFVHAIRGFEATVEGQVDATKGDMMILLDDSNSYWWLVKMCKNLAIGYLPAEYIETPSERLARLNKYKNSETSNSQQSVTLPPLDIVEKTLEAPSPNFRIKRVTFTCSSNSSDDEMDSENDYEAMVNRTVAENGLEIEFSDSSDSSLSAEYRSESEDHVTDSPAYVDLTELEGGFNQFNSTSFQSTSPLGLEIVETEINGSSTTADSKNSHSPYSKFSSAYPDAENSNISKINISIAGNKELYGNATQSDPSLYSTWIANKHKTASSATVDSPLRRSLSVDAMQSNASFSSYSSTSNTDKSLRPSSYSAVSESSNFTHDVSRDNKEISLNAPKSIIVSQSDSFDTSNVTQDAPNDVEKEPISGQMPNNLSVQSLKQLEVYPIRHSVSIEMPSEKLLSPRLYSSSTPSSPTKGFQKDDEEDSENRKQADKVELSPSSLLRQMSLPVDSSSQSDAQCTTSSVYITAERKAFSQSSIDLSTLSNHHVNNEINRRSFAGGFTSLADELSEMRELLHESPAPLECNEEMVIPTPELDASSAIPSSSISHDEDLLPRKNTEESTSSSSFSSLITSPASLQYDENPFKQSVVAELNNNSSSVPFVDSAHASDIHAYDNDHVSTKNKEFNRRLREFILDPDSLSGLYWSVKSAGVRASRRVSRNIEGESVSSDLDDIFANVLKGLSDEMASLLNTNR B1DC53794E56D73E cardiolipin 1',3'-bis(1,2-diacyl-sn-glycero-3-phospho)-sn-glycerol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphatidyl-l-serines phosphatidyl-L-serines small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cdr2_schpo Mitosis inducer protein kinase cdr2 cdr2 SPAC57A10.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTISEVGPWELGLSLGSGGPNSSRLAKHRETGQLAVVKPIVGWSELTSSQQARIEGELVLLRLIEHPNVLQLIDVISAQEQLFVVVEYMPGGELFDCMLRKGSFTEQDTAKFLWQILCGLEYCHKLHICHRDLKPENLYLDAHGSIKIGEFGMASIQQPGKLLQTSCGSPHYASPEIIMGRSYDGCASDIWSCGIIFFALLTGKLPFDDDNIRSLLLKVCQGQFEMPSNISPQAQHLLYRMLDVDSSTRITMEQIREHPFLSCFVHPNISIPIISAPIQPIDPLIVQHLSLVFRCSDDPMPLYEKLASQSPLVEKTLYTLLSRHLHPPSSAAVDRNRAVVDDLLGTAASNGQQMDEEEIEQAINIPTLAPYPISYAAESVPRPATSASPFLTPVTTSGTFNYSFNATNPQSILQRPATTSSAVPQLPKSVTPGLAYPHDSSMLSSNYRPPSALSPRNFNVSINDPEVQLSRRATSLDMSNDFRMNENDPSIVGNLAASNFPTGMGPPRKRVTSRMSEHTGNRVVSFPRGSAFNPRVTRFNVGNEQFSNNIDNNNYNQPYANATMNNSRRLRTPSGERSMRADLSQSPASYDSLNVPKHRRRQSLFSPSSTKKKLSGSPFQPKRSFLRRLFSSEPSCKCVYASLVASELEHEILEVLRRWQLLGIGIADIIYDSVSASISARIKRQNSLNLKPVRFRISVLAEFFGSQAVFVLESGSSTTFDHLATEFQLIFEDKGFLDNLELSYFQASASRPVSRMSVSSSPFAVFRQRQSVQS 2EE2EECABC8A4FAC 2EE2EECABC8A4FAC pom1_schpo DYRK-family kinase pom1 pom1 SPAC2F7.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGYLQSQKAVSLGDENTDALFKLHTSNRKSANMFGIKSELLNPSELSAVGSYSNDICPNRQSSSSTAADTSPSTNASNTNISFPEQEHKDELFMNVEPKGVGSSMDNHAITIHHSTGNGLLRSSFDHDYRQKNSPRNSIHRLSNISIGNNPIDFESSQQNNPSSLNTSSHHRTSSISNSKSFGTSLSYYNRSSKPSDWNQQNNGGHLSGVISITQDVSSVPLQSSVFSSGNHAYHASMAPKRSGSWRHTNFHSTSHPRAASIGNKSGIPPVPTIPPNIGHSTDHQHPKANISGSLTKSSSESKNLSTIQSPLKTSNSFFKELSPHSQITLSNVKNNHSHVGSQTKSHSFATPSVFDNNKPVSSDNHNNTTTSSQVHPDSRNPDPKAAPKAVSQKTNVDGHRNHEAKHGNTVQNESKSQKSSNKEGRSSRGGFFSRLSFSRSSSRMKKGSKAKHEDAPDVPAIPHAYIADSSTKSSYRNGKKTPTRTKSRMQQFINWFKPSKERSSNGNSDSASPPPVPRLSITRSQVSREPEKPEEIPSVPPLPSNFKDKGHVPQQRSVSYTPKRSSDTSESLQPSLSFASSNVLSEPFDRKVADLAMKAINSKRINKLLDDAKVMQSLLDRACIITPVRNTEVQLINTAPLTEYEQDEINNYDNIYFTGLRNVDKRRSADENTSSNFGFDDERGDYKVVLGDHIAYRYEVVDFLGKGSFGQVLRCIDYETGKLVALKIIRNKKRFHMQALVETKILQKIREWDPLDEYCMVQYTDHFYFRDHLCVATELLGKNLYELIKSNGFKGLPIVVIKSITRQLIQCLTLLNEKHVIHCDLKPENILLCHPFKSQVKVIDFGSSCFEGECVYTYIQSRFYRSPEVILGMGYGTPIDVWSLGCIIAEMYTGFPLFPGENEQEQLACIMEIFGPPDHSLIDKCSRKKVFFDSSGKPRPFVSSKGVSRRPFSKSLHQVLQCKDVSFLSFISDCLKWDPDERMTPQQAAQHDFLTGKQDVRRPNTAPARQKFARPPNIETAPIPRPLPNLPMEYNDHTLPSPKEPSNQASNLVRSSDKFPNLLTNLDYSIISDNGFLRKPVEKSRP 3277E7CA840F8BE2 3277E7CA840F8BE2 pp11_schpo Serine/threonine-protein phosphatase PP1-1 dis2 bws1 SPBC776.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNPDVDLDSIIDRLLEVRGSRPGRQVQLSEDEIRFLCNKAREIFISQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLEVICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLNSMDQIQRIMRPTDVPDTGLLCDLLWSDPDKDLTGWGDNDRGVSFTFGPDVVSRFLHKHDMDLVCRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEKKQRYGYQGSSQNWHMTPPRKNKTGNSK 1106BB9C7D6FDCFB 1106BB9C7D6FDCFB 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tea3_schpo Tip elongation aberrant protein 3 Cell polarity protein tea3 tea3 SPAC6G10.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVQKVLSRQSDNSQDVSAEQLDVVESGSIDQQNIRAWVVRKVKENDKRTSTNQSFKWEAVKPASCLDAANEKFMYLHGGREKSGISNSLFKLDLDSCTVYSHNRGEDNDSPARVGHSIVCSADTIYLFGGCDSETDSTFEVGDNSLYAYNFKSNQWNLVSTQSPLPSPRTGHSMLLVDSKLWIFGGECQGKYLNDIHLFDTKGVDRRTQSELKQKANANNVEKANMEFDETDWSWETPFLHSSSPPPRSNHSVTLVQGKIFVHGGHNDTGPLSDLWLFDLETLSWTEVRSIGRFPGPREGHQATTIDDTVYIYGGRDNKGLILNELWAFNYSQQRWSLVSNPIPILLSDSSSYKIVSKNNHILLLYLNALDAPKQLLCYEADPKNLYWDKDKFSDIPVLQHISMKPSNASNHTVSLGYLNDRPNHSKKNSVTSTSSSQFNNFLEQNQKAVRSARHRHYASLDEQGLHSLRNLSKTSGMNHSADFSLHEFGQADPFAYEIEKPIASLPLPNGNDTISRSSESSSPINESESNSLLKLQSDFKFSNSDDRVAWLEEQLLYCMQQGYTLKPPNLFQHVDEKLRLEKKEQLSYLEILKVIEQMLESNEQKFKKQIVSLASENAKLAAQRDAAVENANYSRSLIQKKTTDETVGSLIEKVGKLEYEVQGTLEEATSYYQKNTELQQLLKQNESASELLKSRNEKLCVDYDKLRSVFEEDSSKILSLQKENENLQSQILQISEELVDYRSRCEALEYGNYELETKLIEMHDRVEMQTNVIEASASALDVSNTAILSFEDSLRRERDEKSTLQQKCLNLQYEYENVRIELENLQSRALELESALEQSVSDAKYSKAIMQSGLSKLLSSINENKDNLKEFSKSKQKISYLESQLEGLHELLRESQRLCEGRTKELLNSQQKLYDLKHSYSSVMTEKSKLSDQVNDLTEQAKITQRKLSEVQIALADSKMNQQLSGKDSTDVHLPTDFSASSSPLRSYFNEEDSFNNASAAHSSKESDIPSGGVFTKYRNHFGNLMTSEETKAPDNNDLHKRLSDVINSQQKFLSLSPQVSKDYYDVRSKLNDTAGSFSGEEMRAIDDNYYASRIKQLEDDYQKAITYANCSDESFQQLSHSFM 56DF209D681ED2EA pom1-tea4 5 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1B Addition of Ppc89 to form a Ppc89-GFP-Tea4 fusion resulted in the co-localisation occurring in the lateral cortex, but not the nuclear membrane. phosphatidyl_l_-pom1 2 10 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2D, 4D. cardiolipin-pom1 2 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 2D, 4D. 1_phosphatidy-pom1-1 2 13 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 2D, 4D. 1_phosphatidy-pom1-1 2 11 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2D, 4D. 1_phosphatidy-pom1-2 2 15 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2D, 4D. pom1-pom1 6 13 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation true Fig. 3D Lys728Arg mutation makes Pom1 catalytically inactive. Mutation of alanines in well conserved regions outside the catalytic site reduced activity. cdr2-pom1 6 12 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 13 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q09690:p.Lys728Arg mutation mutation certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:38:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys728arg' Tue Jun 30 15:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys728Arg' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation Fig. 3G Lys728Arg mutation makes Pom1 catalytically inactive. Mutation of alanines in well conserved regions outside the catalytic site reduced activity. pom1-tea4-1 1 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey sh3 region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range O60132:p.Trp167_Trp168delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain WW AA Thu Jul 07 12:07:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp155ala-trp156ala Fri Jul 22 11:09:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp167ala,trp168ala' Wed May 02 16:36:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_trp167-168ala_ala' Tue Jun 30 18:26:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp167_Trp168delinsAlaAla' 61 59 physical association physical association Fig. 5A pom1-tea4-2 3 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O60132:p.Trp167_Trp168delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain WW AA Thu Jul 07 12:07:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp155-trp156ala Fri Jul 22 11:09:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp167ala,trp168ala' Wed May 02 15:04:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_trp167-168ala_ala' Tue Jun 30 18:01:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp167_Trp168delinsAlaAla' 13 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:13:36 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'sh3 binding regions' physical association physical association Fig. 5B dis2-tea4-1 3 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O60132:p.Trp167_Trp168delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain WW AA Thu Jul 07 12:16:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp155ala-trp156ala Fri Jul 22 10:58:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp167ala,trp168ala' Wed May 02 19:09:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_trp167-168ala_ala' Tue Jun 30 16:39:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp167_Trp168delinsAlaAla' O60132:p.[Val235Ala;Phe237Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:08:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val235ala,phe237ala' Tue Jun 30 19:26:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val235Ala;Phe237Ala]' 14 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6C pom1-tea4-3 4 13 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O60132:p.Trp167_Trp168delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain WW AA Thu Jul 07 12:07:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp155ala-trp156ala Fri Jul 22 11:10:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp167ala,trp168ala' Wed May 02 15:28:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_trp167-168ala_ala' Tue Jun 30 16:48:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp167_Trp168delinsAlaAla' physical association physical association Fig. 6E dis2-tea4-2 4 14 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O60132:p.Trp167_Trp168delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain WW AA Thu Jul 07 12:06:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was trp155ala-trp156ala Fri Jul 22 11:12:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'trp167ala,trp168ala' Wed May 02 16:02:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_trp167-168ala_ala' Tue Jun 30 19:24:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp167_Trp168delinsAlaAla' physical association physical association Fig. 6E tea3-tea4 4 8 unspecified role unspecified role neutral component neutral component n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E dis2-pom1 4 13 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role ancillary ancillary 14 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E