MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Insights into the Rrf2 repressor family--the structure of CymR, the global cysteine regulator of Bacillus subtilis. Insights into the Rrf2 repressor family--the structure of CymR, the global cysteine regulator of Bacillus subtilis. FEBS J. (1742-464X) 2011 Shepard W., Soutourina O., Courtois E., England P., Haouz A., Martin-Verstraete I. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shepard W., Soutourina O., Courtois E., England P., Haouz A., Martin-Verstraete I. FEBS J. (1742-464X) 2011 cymr_bacsu HTH-type transcriptional regulator CymR cymR yrzC Cysteine metabolism repressor BSU27520 protein protein bacsu Bacillus subtilis MKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIRGAYGGYVLGSEPDAITAGDIIRVLEGPISPVEVLEDEEPAKRELWIRIRDAVKEVLDSTTLEDLASYTDGEQEAYMFYI mint A469EA0E4133C351 cymr 1 CymR 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction mint CymR from B. subtilis crystallizes in several different crystal forms (see Table S1), but only the orthorhombic form (P212121), which diffracts to the highest resolution will be described here (Table 1). The asymmetric unit of this form contains three homodimers forming a hexamer with 32-point symmetry (Fig. S1). As the unit cell axes are nearly identical in this orthorhombic form, the hexamer in the asymmetric unit is related to the dimer in a cubic form by its 3-fold crystallographic axis. The dimensions and shape of the dimer in the crystal structure (modelled sedimentation coefficient of 2.4S) are consistent with those determined in solution by analytical ultracentrifugation f1b f2 f4 f6 t1 st1 cymr-1 1 CymR 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction mint CymR from B. subtilis crystallizes in several different crystal forms (see Table S1), but only the orthorhombic form (P212121), which diffracts to the highest resolution will be described here (Table 1). The asymmetric unit of this form contains three homodimers forming a hexamer with 32-point symmetry (Fig. S1). As the unit cell axes are nearly identical in this orthorhombic form, the hexamer in the asymmetric unit is related to the dimer in a cubic form by its 3-fold crystallographic axis. The dimensions and shape of the dimer in the crystal structure (modelled sedimentation coefficient of 2.4S) are consistent with those determined in solution by analytical ultracentrifugation st1 sf1