MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Essential residues in the H-NS binding site of Hha, a co-regulator of horizontally acquired genes in Enterobacteria. Essential residues in the H-NS binding site of Hha, a co-regulator of horizontally acquired genes in Enterobacteria. FEBS Lett. (0014-5793) 2011 de Alba CF., Solórzano C., Paytubi S., Madrid C., Juarez A., García J., Pons M. suggested by lperfetto ecobb Escherichia coli (strain B / BL21) pull down pull down predetermined predetermined participant predetermined de Alba CF., Solórzano C., Paytubi S., Madrid C., Juarez A., García J., Pons M. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Essential residues in the H-NS binding site of Hha, a co-regulator of horizontally acquired genes in Enterobacteria. Essential residues in the H-NS binding site of Hha, a co-regulator of horizontally acquired genes in Enterobacteria. FEBS Lett. (0014-5793) 2011 de Alba CF., Solórzano C., Paytubi S., Madrid C., Juarez A., García J., Pons M. suggested by lperfetto in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined de Alba CF., Solórzano C., Paytubi S., Madrid C., Juarez A., García J., Pons M. suggested by lperfetto FEBS Lett. (0014-5793) 2011 hha_ecoli Hemolysin expression-modulating protein Hha b0460 JW0449 hha protein protein ecoli Escherichia coli (strain K12) MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR A77211B87CF0134A hns_ecoli DNA-binding protein H-NS hns bglY cur drdX hnsA msyA osmZ pilG topS b1237 Histone-like protein HLP-II Protein H1 Protein B1 JW1225 Heat-stable nucleoid-structuring protein protein protein ecoli Escherichia coli (strain K12) MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ DIP protein P0ACF8 original sequence version: 44 E628184AC7C86F49 cnu_ecoli OriC-binding nucleoid-associated protein cnu b1625 ydgT H-NS/StpA-binding protein 2 JW1617 Transcription modulator YdgT protein protein ecoli Escherichia coli (strain K12) MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLGQVPKSVWHYVQ CE9FF2E890E78219 CE9FF2E890E78219 hha-hns 2 Hha 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0ACE3:p.Glu25Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E Q Tue Jul 12 10:15:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:41:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu25gln' Tue Jun 30 16:50:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu25Gln' H-NS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain [EBI-6956739] The range 2-48 was N-terminal and is not anymore. direct interaction direct interaction mint f2 sf2c hha-hns-1 2 H-NS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg12Lys binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain [EBI-6956777] The range 2-48 was N-terminal and is not anymore. Hha 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0ACE3:p.Asp48Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:53:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:07:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp48asn' Tue Jun 30 17:19:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp48Asn' direct interaction direct interaction mint f2 sf2f hha-hns-2 2 H-NS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain [EBI-6956799] The range 2-65 was N-terminal and is not anymore. Hha 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0ACE3:p.Asp48Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:53:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:03:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp48asn' Tue Jun 30 19:24:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp48Asn' direct interaction direct interaction f3 mint cnu-hns 2 YdgT 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P64467:p.Asp44Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:52:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:28:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp44asn' Tue Jun 30 16:56:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp44Asn' H-NS 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain [EBI-6956817] The range 2-48 was N-terminal and is not anymore. direct interaction direct interaction sf1 mint hha-hns-3 1 Hha 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P0ACE3:p.Glu25Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E Q Tue Jul 12 10:17:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:18:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu25gln' Tue Jun 30 19:25:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu25Gln' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H-NS 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4a mint hha-hns-4 1 Hha 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P0ACE3:p.Asp48Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:55:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:58:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp48asn' Tue Jun 30 18:27:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp48Asn' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H-NS 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4a mint